PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015891697.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family WRKY
Protein Properties Length: 335aa    MW: 37135.4 Da    PI: 6.9199
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015891697.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.24e-34174231259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCts++C+vkk+vers +dp+vv++tYeg+H+h+
  XP_015891697.1 174 EDGYRWRKYGQKAVKNSPFPRSYYRCTSTSCNVKKRVERSFSDPSVVVTTYEGQHTHP 231
                     8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381302.8E-1181335IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.2E-35158233IPR003657WRKY domain
SuperFamilySSF1182901.83E-29165233IPR003657WRKY domain
PROSITE profilePS5081132.03168233IPR003657WRKY domain
SMARTSM007746.9E-41173232IPR003657WRKY domain
PfamPF031069.3E-27174231IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEKREIIKME ENYNSIGSLT FGEGGGGYTL SGMFDLCEAE KSSSLGFMEL LGVQDISPCL  60
FDFPHTLTAT SSSSSTLLVP SAPTIIPTPA ARKDSSEALN QPATPNSSSI SSASSEAINE  120
EQTKTDNQDQ DEGEEEHEDH QKTKKQLKAK KTNQKRQREP RFAFMTKSEV DHLEDGYRWR  180
KYGQKAVKNS PFPRSYYRCT STSCNVKKRV ERSFSDPSVV VTTYEGQHTH PSPVMARPSH  240
AAAVLPPAST ACATTNFAMP MPTPTTISHY HHHQQNHPFL DNLTPSFNFG YQGSTNSKTN  300
TILHERRLCN LAGPSLLADH GLLQDIIPSH MLKQE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-261662331077Probable WRKY transcription factor 4
2lex_A3e-261662331077Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ3774335e-88GQ377433.1 (Populus tomentosa x P. bolleana) x P. tomentosa WRKY transcription factor 13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015891697.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229002e-74WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLG8Z9V51e-120G8Z9V5_HEVBR; WRKY1
STRINGPOPTR_0002s19390.13e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-57WRKY DNA-binding protein 23