PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890683.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 259aa    MW: 29515.2 Da    PI: 6.2176
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890683.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.56.1e-40161151100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn++k++k+l++ ++++am+++++++++ra+dPv G++++i+++q+q+e  kael+
  XP_015890683.1  16 ACAACKYQRRKCAPDCILAPYFPHDRQRQFLNAHKLFGVSNITKIIKKLDQPDKDKAMHTIIFQSDVRANDPVGGCYRIIREYQRQIEYYKAELD 110
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      + ++
  XP_015890683.1 111 IVLHQ 115
                     88776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.52815116IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-3716111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MTTSNIPTKG NGNTQACAAC KYQRRKCAPD CILAPYFPHD RQRQFLNAHK LFGVSNITKI  60
IKKLDQPDKD KAMHTIIFQS DVRANDPVGG CYRIIREYQR QIEYYKAELD IVLHQLAICR  120
AQAHHHVQVP EAAAVAGEPN LNCEMVNVVD PLSLYNNPMA MAMQPHYQCQ LQPQHESYVN  180
VVHDQGNHGL QEDVSSWVMQ DDSLHSLHTK QDINGDDHDC DEDIKPLFEV ACERNENKFD  240
TQDIVEHRFV PSPQLLTSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890683.10.0PREDICTED: LOB domain-containing protein 22
SwissprotQ9LRW15e-64LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A0D2VJ031e-89A0A0D2VJ03_G
STRINGGLYMA07G01170.28e-70(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.13e-65LOB domain-containing protein 22