PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family CAMTA
Protein Properties Length: 1073aa    MW: 120756 Da    PI: 5.5852
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890631.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1179.24.9e-56201362118
            CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqr 96 
                     ++ ++rwl++ ei++iL n+++++++ e+++ p+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+e+n++fqr
  XP_015890631.1  20 MEAQHRWLRPAEICEILRNYKRFRIAPEPANMPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENFQR 114
                     5569******************************************************************************************* PP

            CG-1  97 rcywlLeeelekivlvhylevk 118
                     r+yw+Lee+l++ivlvhy+evk
  XP_015890631.1 115 RSYWMLEEDLSHIVLVHYREVK 136
                     *******************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143782.89115141IPR005559CG-1 DNA-binding domain
SMARTSM010762.7E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038593.5E-4921134IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.101.7E-6489575IPR013783Immunoglobulin-like fold
SuperFamilySSF812965.91E-19490575IPR014756Immunoglobulin E-set
PfamPF018333.0E-8490574IPR002909IPT domain
PROSITE profilePS5029717.29655795IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.8E-15674785IPR020683Ankyrin repeat-containing domain
CDDcd002043.33E-11682783No hitNo description
Gene3DG3DSA:1.25.40.201.4E-15684789IPR020683Ankyrin repeat-containing domain
SMARTSM002480.032723752IPR002110Ankyrin repeat
PROSITE profilePS500889.217723755IPR002110Ankyrin repeat
SMARTSM002482200763792IPR002110Ankyrin repeat
SuperFamilySSF525401.14E-7891949IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM0001516898920IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.144900928IPR000048IQ motif, EF-hand binding site
PfamPF006120.066901919IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0039921943IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.487922946IPR000048IQ motif, EF-hand binding site
PfamPF006122.2E-4924943IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1073 aa     Download sequence    Send to blast
MAESRRYGLG NQLDIEQILM EAQHRWLRPA EICEILRNYK RFRIAPEPAN MPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSIDVLH CYYAHGEDNE NFQRRSYWML  120
EEDLSHIVLV HYREVKGNRT SFNRIRENED AETAPNSEID SSFSSSFPPN SYQISQTTDT  180
TSLNSAQASE YEDAESAYNQ ASSTLHSFLE LQRPMAEQIN SGLSDPYYPM MFSNDYQGKS  240
SAIPGIDISS LPQTDINEGS KSVGVTYEPR KNLDFPLRKN ILVNTSAGTQ SLPLQPSLSA  300
IQSENLGIVQ KQEQENFGQL FSEGIGQRLE FGSQPQVQEE WQASGGHSSS LSKWPADQNL  360
HQDAASNLAS ERETNGVELL QSQHPNTQHE YDLKSVQENN VFLEGKPNYI SGIKQSLLDS  420
SFTDEGLKKL DSFNRWMSKE LGDVNESHMQ TSSEAYWDTV EAENADGDSS QVRLDTYMLG  480
PSLSQDQLFT IIDFSPNWAF EDSEVKVLIT GRFLDHQAES SKWSCMFGEV EVPAEVIADG  540
VLRCHTPIHK AGRVPFYVTC SNRLACSEVR EFEYRVNEVR DMDLKYDDSS CTTEELNLRF  600
GKLLCLDSAC PTSGPNNLVE KSQLSSKISL LLREDEDEWD QMLKLTSENN FSVERVEEQL  660
HQKLLKGKLH GWLLQKVAEG GKGASVLDEG GQGVLHFAAA LDYEWALEPT IIAGVSVNFR  720
DVNGWTALHW AAFCGRERTV ASLISLGAAP GALTDPSPKY QTGGKTPSDL AYAKGHKGIA  780
GYLAESALSA HLLSLNLDKK EGNAAETSGV KAVHTISERV ATPVKDGDLN DRLSLKDSLA  840
AVCNATQAAA RIHQVFRVQS FQRKQLKEYG DDKFGMSDEQ ALSLIAVKSA KQGHHDEHVN  900
AAAIRIQNKF RSWKGRKDFL IIRQRIVKIQ AHVRGHQVRK NYRKITWSVG IVEKIILRWR  960
RKGSGLRGFK SEALTEGPSK ENSLSKEDDD DFLKEGRKQA EVRLQKALNR VKSMVQYPEA  1020
RDQYRRLLNV VSEFQGTKVQ FDTDPNNSET ADFDDDLIDL EALLDEDTYM PTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cxk_A1e-14491575989calmodulin binding transcription activator 1
2cxk_B1e-14491575989calmodulin binding transcription activator 1
2cxk_C1e-14491575989calmodulin binding transcription activator 1
2cxk_D1e-14491575989calmodulin binding transcription activator 1
2cxk_E1e-14491575989calmodulin binding transcription activator 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4345406e-38AM434540.2 Vitis vinifera contig VV78X210461.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890632.10.0PREDICTED: calmodulin-binding transcription activator 3 isoform X1
RefseqXP_015890631.10.0PREDICTED: calmodulin-binding transcription activator 3 isoform X1
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLW9QNC60.0W9QNC6_9R
STRINGVIT_07s0141g00250.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82842735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1