PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890329.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRAS
Protein Properties Length: 470aa    MW: 52553.1 Da    PI: 5.8251
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890329.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS302.31.2e-92554672373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn...sseelaalkl..fsevsPil 91 
                     ++lL++cA+a++s+d++laq++L+ l+++a  dgd +qRl+  f++AL  r ars+s ++ a  +++++ +n   +++++++ +l  f +++P++
  XP_015890329.1  55 EQLLVHCANAIESNDATLAQQILWVLNNIAPADGDYNQRLTCGFLRALIVRAARSGSCTMLAAMANANNMTNltiHTHKFSVIELasFIDLTPWH 149
                     79****************************************************777666555555555455345444455555588******** PP

            GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvl.. 181
                     +f++ +aN aIleav+g + +Hi+D+++++++Q p+L +a+asR e pp++++T+ g+ e +      ++ee+g +L +fA++ +v +ef+v+  
  XP_015890329.1 150 RFGFTAANAAILEAVDGYSIIHIVDLSLTHCMQIPTLVDAIASRHEVPPRVKLTVAGATEDVppmLDLSYEELGLKLVNFARSRNVILEFQVIps 244
                     **********************************************************887798888999***********************99 PP

            GRAS 182 .....vakrledleleeLrvkp.gEalaVnlvlqlhrll...........................desvsleserdevLklvkslsPkvvvvve 243
                           a+ +e+l++++L   + gEal++n++++lh+++                           ++s+s++s r+ +Lk ++sl+P++vv+v+
  XP_015890329.1 245 sysegFANLIEQLRMQHLVYAEsGEALVINCQMMLHHIPeetlssssssssidpnsglssygfessSSSASITSLRTMFLKSLRSLEPTIVVLVD 339
                     96666666777777777776669*****************************************9999999999********************* PP

            GRAS 244 qeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqak 338
                     +++d++s++++ r+ +a++y +  +d++++ lp+ s++r+++E+  + ++i+nv+a+eg +r+er e ++kW er+++a F++++++e+a+ ++k
  XP_015890329.1 340 EDVDLTSNNLVCRLRSAFNYLWIPYDTVDTFLPKGSKQRQWYEAD-ICWKIENVIAHEGLQRVERIEPKSKWVERMRNANFRSLSFGEDAVLEVK 433
                     *********************************************.************************************************* PP

            GRAS 339 lllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     ++l +++  g+ ++ e++ lvl+Wk++++v+++aW
  XP_015890329.1 434 TMLDEHA-AGWGLKREEEDLVLTWKGHNVVFATAW 467
                     *******.8999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.90128449IPR005202Transcription factor GRAS
PfamPF035144.0E-9055467IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MMQFTEIPPP LLHHTSPLFS NQTLMNKNQI HRTRPWPGFP SSKALGNFGD ANCMEQLLVH  60
CANAIESNDA TLAQQILWVL NNIAPADGDY NQRLTCGFLR ALIVRAARSG SCTMLAAMAN  120
ANNMTNLTIH THKFSVIELA SFIDLTPWHR FGFTAANAAI LEAVDGYSII HIVDLSLTHC  180
MQIPTLVDAI ASRHEVPPRV KLTVAGATED VPPMLDLSYE ELGLKLVNFA RSRNVILEFQ  240
VIPSSYSEGF ANLIEQLRMQ HLVYAESGEA LVINCQMMLH HIPEETLSSS SSSSSIDPNS  300
GLSSYGFESS SSSASITSLR TMFLKSLRSL EPTIVVLVDE DVDLTSNNLV CRLRSAFNYL  360
WIPYDTVDTF LPKGSKQRQW YEADICWKIE NVIAHEGLQR VERIEPKSKW VERMRNANFR  420
SLSFGEDAVL EVKTMLDEHA AGWGLKREEE DLVLTWKGHN VVFATAWLCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B9e-434946782472Protein SHORT-ROOT
5b3h_B3e-434946728418Protein SHORT-ROOT
5b3h_E3e-434946728418Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015890329.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890329.10.0scarecrow-like protein 32
SwissprotQ9SN221e-177SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A067GH430.0A0A067GH43_CITSI; Uncharacterized protein
TrEMBLV4RWS10.0V4RWS1_9ROSI; Uncharacterized protein
STRINGXP_006426063.10.0(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-176GRAS family protein