PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015890048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 316aa    MW: 34976 Da    PI: 6.4263
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015890048.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.42.4e-4371061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk++rrkC+++Cv+apyfp +qp+kf+nvhk+FGasnv kll++l+ ++reda++sl+yeA+ar+rdPvyG+vg+i+ lq++l++++++l 
  XP_015890048.1   7 PCAACKLQRRKCTQECVFAPYFPPDQPQKFENVHKVFGASNVAKLLNELNANQREDAVNSLAYEADARLRDPVYGCVGLISILQHKLKEVQSDLY 101
                     7********************************************************************************************99 PP

          DUF260  96 llkee 100
                      +k+e
  XP_015890048.1 102 NAKKE 106
                     98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.056107IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSPSNSPCAA CKLQRRKCTQ ECVFAPYFPP DQPQKFENVH KVFGASNVAK LLNELNANQR  60
EDAVNSLAYE ADARLRDPVY GCVGLISILQ HKLKEVQSDL YNAKKELATY LGPQALHQIL  120
QPPTYLPQTH PGPSSSSVLP YNMSPMMGIP TGPSPSGQLV ICDPLQQQHQ TQQIFEAQQL  180
AAAVAAREQQ EMFRTSFEQK QALHQQQQQT QQPQDLLRFN SGGFDSASGS VTATGFNQMT  240
AAAMSPSLAL GNFDLSYHIQ PQQPEHHNPH HTQLQAQILL PPQEPQVQQQ QSQQTQQSQQ  300
QQTDQGEEGR GVGQTC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015868740.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_015890048.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-87LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS921e-124A0A0B0PS92_G
STRINGVIT_07s0197g00020.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-80ASYMMETRIC LEAVES 2-like 1