PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015889629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Nin-like
Protein Properties Length: 336aa    MW: 38697.3 Da    PI: 9.5968
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015889629.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK81.21e-25202251352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ++i l+dl+kyF+ pi +A+++L+++lTvLKr+CR++GI+RWPhRkiks+
  XP_015889629.1 202 ARIALSDLAKYFDVPIIEASRSLKIGLTVLKRKCREFGIPRWPHRKIKSI 251
                     789*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.951186272IPR003035RWP-RK domain
PfamPF020423.5E-21204251IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MDSSNTHFLQ SLLVFSNSAN QELIRSLHKY RLDNGKGTEI ERLFVFSKNG PYMEMAAVPL  60
LKKSLKFRIS EVYEGFVHGL WVCIFAFHAG HRPSTTCFPS ILSISRNPKL KSIPSFANEL  120
QLIFQSSYIA EKKEPLLISP KSQTNNENHH QSKRSQPVLD QDLNCLPYSV TMSESAEEEQ  180
IDQSLPGTLE KKKKRAASDH IARIALSDLA KYFDVPIIEA SRSLKIGLTV LKRKCREFGI  240
PRWPHRKIKS IDSLIRDLQE EKCQQQEDTA AAIAVEKRQK MLESEKESIE RKPFLEIKSE  300
TKRFRQDVFK RRHRARALMS QDLTTSDSEN AYELQE
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015889629.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889629.10.0protein RKD5
SwissprotO817914e-88RKD5_ARATH; Protein RKD5
TrEMBLA0A2P5BMN41e-157A0A2P5BMN4_PARAD; RWP-RK domain containing protein
STRINGXP_010103258.11e-146(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.11e-90RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Tedeschi F,Rizzo P,Rutten T,Altschmied L,Bäumlein H
    RWP-RK domain-containing transcription factors control cell differentiation during female gametophyte development in Arabidopsis.
    New Phytol., 2017. 213(4): p. 1909-1924
    [PMID:27870062]