PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015889088.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 245aa    MW: 28035.6 Da    PI: 6.7843
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015889088.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260113.61.3e-35101101101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCa+Ck++r+kC ++C lapyfpa++ ++f+n+ +lFG+sn++k+++++++++r++a++s+++e++ r +dPv+G++gv ++l++++ + +++l+
  XP_015889088.1  10 ACASCKHQRKKCDDNCELAPYFPASRFREFQNAYRLFGVSNIQKIMASVEPHQRQAAAESILMEGNYRRNDPVNGCLGVCRNLNSHIISYEKQLK 104
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                      ++++l
  XP_015889088.1 105 IVNQQL 110
                     999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2459110IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-3310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MSKESGVYQA CASCKHQRKK CDDNCELAPY FPASRFREFQ NAYRLFGVSN IQKIMASVEP  60
HQRQAAAESI LMEGNYRRND PVNGCLGVCR NLNSHIISYE KQLKIVNQQL AMFRQREKFD  120
RHQNHLSNSY ISSMPSISSE KSSSLNLHRD HQFDALKFPP PLLSDMARDD YMGDAKNLQQ  180
AGYIYRSTLE EGADLKPFDI QLMDQIMESD EHGSVLETEE LSAGLKAHGK QLLQGMRTED  240
EMKYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015889088.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW12e-35LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A067E2B96e-57A0A067E2B9_CITSI; Uncharacterized protein (Fragment)
STRINGAT3G13850.16e-33(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-36LOB domain-containing protein 22