PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015888949.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB_related
Protein Properties Length: 775aa    MW: 85253.1 Da    PI: 6.1534
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015888949.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
   XP_015888949.1 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.36E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-82170IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002493.2E-132467IPR001005SANT/Myb domain
CDDcd001671.51E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 775 aa     Download sequence    Send to blast
MDTYSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEALVKG VPVGQTLDID IPPPRPKRKP SNPYPRKTSA AIPTSHVGVK  120
DVKLLPSESS SHCKQVLDLE KEPIPERPGG EEDPTNEKEN PTNEKENQDE NCSEVFTMLQ  180
EAHYSSISSA NRNSMPSPVA LTNACTFREF VPSSKQANQD ESNGSYVTIE HQGNQNLEKV  240
NAKQRAVQDN ATNRRSKFDN SNSPLEELVQ NEKRNDLNCE MPTEELQTTQ NYPRHVPVHV  300
LDGSLGNCTQ TPSADISFQD PIFHPIGEVP GHPTVFPNPA ASATTEHQSN VSRSSVHQSF  360
PPFHPTFTPI RHDQDEYRSF LQMSSTFSSL IVSTLLQNPA AHAAASFAAT FWPYANMETS  420
ADSPACPHGG FPSRQMNSTP SMAAITAATV AAATAWWAAH GLLPLCAPLH TGFACAPAST  480
SVPSMDTGQA LAAKTERGEN SPNPPLQDQL DVEHSEALQS QHSASKSPTQ SSTESEESGA  540
AKPDTCLKAA DDEKATAEPD LHDSNPVKSR KQVDRSSCGS NTASSSEVET DALEKHDKGK  600
EELKESDKNH PATESTNRRI RSTSTLIDSW KEVSEEGRLA FQALFSREVL PQSFSPPRDI  660
LNKKENQNNS AEGDKQNVEE KGGDTLLLDL NRRILLSRSI QQEVEKNASS RSDTNGDEGL  720
LTIGLGHGKL KTRRTGFKPY KRCSVEAKEN RVGSAGCQGE EKGPKRLRLE GEAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015888949.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8133161e-133KR813316.1 Betula platyphylla LHY mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888949.10.0protein LHY isoform X1
TrEMBLM5XF420.0M5XF42_PRUPE; Uncharacterized protein
STRINGEMJ201280.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-135MYB_related family protein