PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015888417.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LFY
Protein Properties Length: 402aa    MW: 45211.7 Da    PI: 6.7529
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015888417.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY642.94.8e-19613851385
         FLO_LFY   1 mdpeafsaslfkwdpraaaaa.pparlleeaavseap.....leaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddl 89 
                     md++ f+aslfkwdpr  ++  p+++++e  ++++++     ++aa+a + r+l +leelf+ayG+ry+t+akiaelGftvstL+dmkd+eld++
  XP_015888417.1   1 MDSDPFTASLFKWDPRGGMVVqPSRSIMEPLQAATQHtgslpASAATAYSVRQLGGLEELFQAYGIRYYTAAKIAELGFTVSTLLDMKDDELDEM 95 
                     9*************999885515555555554444443432233333334444559*************************************** PP

         FLO_LFY  90 mkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeet.aldalsqeglseepvqeekeaagsggeglgeaelvaaeekksee 183
                     m+sls+ifr++llvGeryGikaavra rrrl++++  ++rr+l+ +d+ t aldalsqeglseepvqeeke +gs g+g   +e+vaa e+k   
  XP_015888417.1  96 MNSLSQIFRWELLVGERYGIKAAVRAHRRRLDDDD--SRRRHLIVSDTPTnALDALSQEGLSEEPVQEEKEVVGSVGGG--MWEVVAAGERK--- 183
                     *********************************77..66677776665544********************99998888..99999998533... PP

         FLO_LFY 184 ekkkaskkkqkrkkkkelkseededeeeeededeegsgedge.erqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekc 277
                      kk++++ k +rk+  e+++++ +de++e+d++++g+g++g  erqrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qvq+iakerGekc
  XP_015888417.1 184 -KKQRRSLKVHRKTVVENHENDADDEDDEDDDNGNGNGHGGIsERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKC 277
                     .233333366666666666666566666666666677776645**************************************************** PP

         FLO_LFY 278 PtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPt 372
                     PtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrra kergenvGawrqacykplvaiaarqgwdid++fnahprLsiWYvPt
  XP_015888417.1 278 PTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNALRRALKERGENVGAWRQACYKPLVAIAARQGWDIDSIFNAHPRLSIWYVPT 372
                     *********************************************************************************************** PP

         FLO_LFY 373 kLrqLChlerska 385
                     kLrqLCh+er++a
  XP_015888417.1 373 KLRQLCHAERNNA 385
                     **********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.4E-2021385IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MDSDPFTASL FKWDPRGGMV VQPSRSIMEP LQAATQHTGS LPASAATAYS VRQLGGLEEL  60
FQAYGIRYYT AAKIAELGFT VSTLLDMKDD ELDEMMNSLS QIFRWELLVG ERYGIKAAVR  120
AHRRRLDDDD SRRRHLIVSD TPTNALDALS QEGLSEEPVQ EEKEVVGSVG GGMWEVVAAG  180
ERKKKQRRSL KVHRKTVVEN HENDADDEDD EDDDNGNGNG HGGISERQRE HPFIVTEPGE  240
VARGKKNGLD YLFHLYEQCR DFLIQVQNIA KERGEKCPTK VTNQVFRYAK KAGASYINKP  300
KMRHYVHCYA LHCLDEEASN ALRRALKERG ENVGAWRQAC YKPLVAIAAR QGWDIDSIFN  360
AHPRLSIWYV PTKLRQLCHA ERNNATLAAS SSVSTGADHL PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1102253843162PROTEIN LEAFY
2vy2_A1e-1102253843162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015888417.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1650970.0JN165097.2 Ziziphus jujuba cultivar Jinsi No. 4 LFY mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310806.10.0floricaula/leafy homolog
SwissprotO040640.0FLLH_POPTR; Floricaula/leafy homolog
TrEMBLG1FCB10.0G1FCB1_ZIZJJ; LFY
STRINGEOY226620.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-147floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Tuskan GA, et al.
    The genome of black cottonwood, Populus trichocarpa (Torr. & Gray).
    Science, 2006. 313(5793): p. 1596-604
    [PMID:16973872]