PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015888368.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family M-type_MADS
Protein Properties Length: 350aa    MW: 40235.9 Da    PI: 8.6237
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015888368.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.41.9e-181054246
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                     ien+  r  tf kR++g+ KK +ELS+LC+++v+ ii++++++ 
  XP_015888368.1 10 LIENEKSRRLTFQKRKKGLTKKCSELSTLCGIDVCTIIYGPNNHT 54
                    59****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.287152IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.22E-232101IPR002100Transcription factor, MADS-box
CDDcd002661.33E-24271No hitNo description
PRINTSPR004041.5E-11323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-191153IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGRGKLKMEL IENEKSRRLT FQKRKKGLTK KCSELSTLCG IDVCTIIYGP NNHTKDPSVE  60
LETWPKDHNE VIRIIQRYQA ATIYKPPKKS SNLSDFYIER KKNIDSKIDK LRKAKYPISD  120
ELITHYCASS GDHQLGLLLR RLDLKIEAVK RMIEFRKHNQ VINYNPHDHV DHLFDQKFVP  180
FNNNNIPQLD QMVRSVPMPQ YVYPNPMIDH NQMRMMMMMN DQAAASGYDH HQNVAAGTSS  240
SSDSVVDYNQ FSLYSNNPLS SGGVTGLFDP TVGMVENYML LNNIGNNSIP SSSTSQYCQQ  300
QQPLQMMPIM QYYPSSMELP GIPSQMNVSD HKGKSHFDEI TDFYLKNEKL
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015888368.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888613.11e-140uncharacterized protein LOC107423552
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-20M-type_MADS family protein