PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015887148.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 89aa    MW: 9968.2 Da    PI: 6.5011
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015887148.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26053.37.8e-1715745101
          DUF260  45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                     +l++lp + r +a++sl+yeA++r++dPvyG++g+i++l+qq++++++++a++++++
  XP_015887148.1   1 MLQQLPIHLRVEAAESLYYEAKCRIEDPVYGCAGIISQLHQQIHNAESQVAKIRAQI 57 
                     7999***********************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.5E-14154IPR004883Lateral organ boundaries, LOB
PROSITE profilePS5089111.034157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MLQQLPIHLR VEAAESLYYE AKCRIEDPVY GCAGIISQLH QQIHNAESQV AKIRAQIAFL  60
NSNAHEMESN TNNLIQGNSK IGQSQFQTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015887148.14e-60PREDICTED: LOB domain-containing protein 24-like
SwissprotP594685e-19LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A059DJZ97e-30A0A059DJZ9_EUCGR; Uncharacterized protein
STRINGPOPTR_0012s13910.18e-26(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-20LOB domain-containing protein 24