PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015887130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 155aa    MW: 17720.9 Da    PI: 8.4783
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015887130.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.37.8e-36251233101
          DUF260   3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                     +aCk+ rrkC +dC++ pyfp+++p+++a+vh+++Ga+ + ++l++lp + r +a++sl+yeA++r++dPvyG++g+i++l+qq++++++++a++
  XP_015887130.1  25 NACKYSRRKCRSDCIFYPYFPSNNPERYACVHQIYGANSIRNTLQQLPIHLRAEAAESLYYEAKCRIEDPVYGCAGIISQLHQQIHNAESQVAKV 119
                     8*********************************************************************************************9 PP

          DUF260  98 keel 101
                     ++++
  XP_015887130.1 120 RAQI 123
                     9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.54422123IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-3525120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDGNRLHSLQ YSFGNFCRPS RMAANACKYS RRKCRSDCIF YPYFPSNNPE RYACVHQIYG  60
ANSIRNTLQQ LPIHLRAEAA ESLYYEAKCR IEDPVYGCAG IISQLHQQIH NAESQVAKVR  120
AQIAFLNFNA HEMDSNTNNL IQGHSNIGQF QFQAP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015887130.11e-113PREDICTED: LOB domain-containing protein 24-like
SwissprotP594685e-42LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A059DJZ92e-52A0A059DJZ9_EUCGR; Uncharacterized protein
STRINGPOPTR_0012s13910.13e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-43LOB domain-containing protein 24