PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015886300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family CAMTA
Protein Properties Length: 1057aa    MW: 118383 Da    PI: 5.3202
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015886300.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1185.65.2e-58121273118
            CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrr 97 
                     + ++rwl++ ei++iL n++k+++t+e++trp+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+++vl+cyYah+e+n++fqrr
  XP_015886300.1  12 EAQHRWLRPAEICEILRNYQKFRITSEPPTRPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRR 106
                     449******************************************************************************************** PP

            CG-1  98 cywlLeeelekivlvhylevk 118
                     +yw+Le+el +iv+vhylevk
  XP_015886300.1 107 SYWMLEQELMHIVFVHYLEVK 127
                     ******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143785.3086132IPR005559CG-1 DNA-binding domain
SMARTSM010762.2E-849127IPR005559CG-1 DNA-binding domain
PfamPF038591.5E-5112126IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.103.4E-5445556IPR013783Immunoglobulin-like fold
SuperFamilySSF812963.67E-14471556IPR014756Immunoglobulin E-set
PfamPF018331.7E-4471546IPR002909IPT domain
PROSITE profilePS5029719.571659766IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.64E-18659766IPR020683Ankyrin repeat-containing domain
CDDcd002044.10E-16661764No hitNo description
Gene3DG3DSA:1.25.40.203.6E-18663770IPR020683Ankyrin repeat-containing domain
PfamPF127966.9E-8666731IPR020683Ankyrin repeat-containing domain
PROSITE profilePS500889.511672704IPR002110Ankyrin repeat
SMARTSM00248670672701IPR002110Ankyrin repeat
PROSITE profilePS5008810.472705737IPR002110Ankyrin repeat
SMARTSM002489.2E-4705734IPR002110Ankyrin repeat
SuperFamilySSF525405.84E-8879931IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.076880902IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.766881910IPR000048IQ motif, EF-hand binding site
PfamPF006120.0018882901IPR000048IQ motif, EF-hand binding site
SMARTSM000150.017903925IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.304904928IPR000048IQ motif, EF-hand binding site
PfamPF006124.7E-4906925IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1057 aa     Download sequence    Send to blast
MDILDIQQLS VEAQHRWLRP AEICEILRNY QKFRITSEPP TRPPSGSLFL FDRKVLRYFR  60
KDGHNWRKKK DGKTVKEAHE KLKVGSIDVL HCYYAHGEDN ENFQRRSYWM LEQELMHIVF  120
VHYLEVKGNR TNIGGVRETD EFSQDLSKAS PQISSSSANN CKEPSGNTDY TSPSSSLTSL  180
YEDADTGDSH QASSTYHSYS GSPQPQVGNG LLMNNIDVSF LTGPAAKNHE GHSSINGADY  240
MPHLEKDRPM YNDSPGYIVG QQKTLGLGSW EEILEQCTMG FHTDPACTGV ALEQQNMTLN  300
GLSACDSTAE KELDSSLPTH SSWQIPFEDN SLLLPKLSVD QPPNSELPCY QDDLFNTLLH  360
QQKEKPAQSN LQAQLPNAES ECLIASNADD DIYADGNMNY SLSLRRQLFD GEEGLKKVDS  420
FSRWVSKELG EVDNLQMQSS SGISWSTVEC GNVVDDSSLS PSLSQDQLFS IIDVSPKWGY  480
ADLETEVLTT GTFLKSQQEV AKYNWSCMFG EVEGPAEILV DGVLCCHAPP HRSGQVPFYV  540
TCSNRIACSE VREFDYLLGS TKGLDITNIY GSDTDEMLLH VRLERLLSLG SVKPSKNIFK  600
DVTEKKDLIN KIISLKEEEE SNQKVDLTPE NDLSQYEVKE HLLKKLIKDK LYSWLFHKVT  660
EDGKGPSVLD DNGQGALHLA AALGYNWAIK PIVTSGVSIN FRDVNGWTAL HWAALYGREQ  720
TVALLVSLGA APGAVTDPSP EFPLGRTPAD LASVTGQKGI SGFLAESSLT SYLSSLTVNE  780
PKNDCAAENS GTTAVQTVSE RTATPMNYFD MPDTLSLKDS LTAVRNATQA ADRIHLMFRM  840
QSFERRQLSD LGDDEFGLSD EHALSLLATK TSKAGPSYGQ AHAAAVHIQK KYRGWKKRKE  900
FLIIRQRIVK IQAHVRGHQV RKQYRAIIWS VGILEKIILR WRRKGSGLRG FRNDAVIKDS  960
QPDPQHMPLK DDDYDFFKEG RKQTEERLQS ALTRVKSMVQ YPEGRAQYRR LLNVVDGFRE  1020
TKVDDMALNS ETADSDENLV DIDTLLHDDT FMSIAFE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886300.10.0PREDICTED: calmodulin-binding transcription activator 2-like isoform X2
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLW9RHV90.0W9RHV9_9R
STRINGGLYMA05G24430.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains