PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015886299.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family CAMTA
Protein Properties Length: 1066aa    MW: 119329 Da    PI: 5.4324
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015886299.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1185.65.2e-58211363118
            CG-1   3 kekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrr 97 
                     + ++rwl++ ei++iL n++k+++t+e++trp+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+++vl+cyYah+e+n++fqrr
  XP_015886299.1  21 EAQHRWLRPAEICEILRNYQKFRITSEPPTRPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSIDVLHCYYAHGEDNENFQRR 115
                     449******************************************************************************************** PP

            CG-1  98 cywlLeeelekivlvhylevk 118
                     +yw+Le+el +iv+vhylevk
  XP_015886299.1 116 SYWMLEQELMHIVFVHYLEVK 136
                     ******************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143785.30815141IPR005559CG-1 DNA-binding domain
SMARTSM010762.2E-8418136IPR005559CG-1 DNA-binding domain
PfamPF038591.5E-5121135IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.103.5E-5454565IPR013783Immunoglobulin-like fold
PfamPF018331.7E-4480555IPR002909IPT domain
SuperFamilySSF812963.67E-14480565IPR014756Immunoglobulin E-set
SuperFamilySSF484032.8E-18668775IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029719.571668775IPR020683Ankyrin repeat-containing domain
CDDcd002044.15E-16670773No hitNo description
Gene3DG3DSA:1.25.40.203.6E-18672779IPR020683Ankyrin repeat-containing domain
PfamPF127966.9E-8675740IPR020683Ankyrin repeat-containing domain
SMARTSM00248670681710IPR002110Ankyrin repeat
PROSITE profilePS500889.511681713IPR002110Ankyrin repeat
SMARTSM002489.2E-4714743IPR002110Ankyrin repeat
PROSITE profilePS5008810.472714746IPR002110Ankyrin repeat
SuperFamilySSF525405.84E-8888940IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.076889911IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.766890919IPR000048IQ motif, EF-hand binding site
PfamPF006120.0019891910IPR000048IQ motif, EF-hand binding site
SMARTSM000150.017912934IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.304913937IPR000048IQ motif, EF-hand binding site
PfamPF006124.7E-4915934IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0071275Biological Processcellular response to aluminum ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1066 aa     Download sequence    Send to blast
MAERGSYGLS PRLDIQQLSV EAQHRWLRPA EICEILRNYQ KFRITSEPPT RPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHEK LKVGSIDVLH CYYAHGEDNE NFQRRSYWML  120
EQELMHIVFV HYLEVKGNRT NIGGVRETDE FSQDLSKASP QISSSSANNC KEPSGNTDYT  180
SPSSSLTSLY EDADTGDSHQ ASSTYHSYSG SPQPQVGNGL LMNNIDVSFL TGPAAKNHEG  240
HSSINGADYM PHLEKDRPMY NDSPGYIVGQ QKTLGLGSWE EILEQCTMGF HTDPACTGVA  300
LEQQNMTLNG LSACDSTAEK ELDSSLPTHS SWQIPFEDNS LLLPKLSVDQ PPNSELPCYQ  360
DDLFNTLLHQ QKEKPAQSNL QAQLPNAESE CLIASNADDD IYADGNMNYS LSLRRQLFDG  420
EEGLKKVDSF SRWVSKELGE VDNLQMQSSS GISWSTVECG NVVDDSSLSP SLSQDQLFSI  480
IDVSPKWGYA DLETEVLTTG TFLKSQQEVA KYNWSCMFGE VEGPAEILVD GVLCCHAPPH  540
RSGQVPFYVT CSNRIACSEV REFDYLLGST KGLDITNIYG SDTDEMLLHV RLERLLSLGS  600
VKPSKNIFKD VTEKKDLINK IISLKEEEES NQKVDLTPEN DLSQYEVKEH LLKKLIKDKL  660
YSWLFHKVTE DGKGPSVLDD NGQGALHLAA ALGYNWAIKP IVTSGVSINF RDVNGWTALH  720
WAALYGREQT VALLVSLGAA PGAVTDPSPE FPLGRTPADL ASVTGQKGIS GFLAESSLTS  780
YLSSLTVNEP KNDCAAENSG TTAVQTVSER TATPMNYFDM PDTLSLKDSL TAVRNATQAA  840
DRIHLMFRMQ SFERRQLSDL GDDEFGLSDE HALSLLATKT SKAGPSYGQA HAAAVHIQKK  900
YRGWKKRKEF LIIRQRIVKI QAHVRGHQVR KQYRAIIWSV GILEKIILRW RRKGSGLRGF  960
RNDAVIKDSQ PDPQHMPLKD DDYDFFKEGR KQTEERLQSA LTRVKSMVQY PEGRAQYRRL  1020
LNVVDGFRET KVDDMALNSE TADSDENLVD IDTLLHDDTF MSIAFE
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00043PBMTransfer from AT5G64220Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886299.10.0PREDICTED: calmodulin-binding transcription activator 2-like isoform X1
SwissprotQ6NPP40.0CMTA2_ARATH; Calmodulin-binding transcription activator 2
TrEMBLW9RHV90.0W9RHV9_9R
STRINGGLYMA05G24430.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74062642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64220.20.0Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains