PlantRegMap
Plant Transcription Factor Database
PlantTFDB
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015886154.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GeBP
Protein Properties Length: 417aa    MW: 45253.1 Da    PI: 5.2949
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015886154.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573123.31.1e-38190283197
          DUF573   1 klfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                     klfqrlwse+Deiv+L+G+id++ak+g++ps+d++af++f+kks++++v+k ql +K+rrLKkK++++  k   gk+ + +k+h+ k+felskki
  XP_015886154.1 190 KLFQRLWSEDDEIVILRGMIDYTAKKGADPSADMNAFHDFIKKSLQINVTKAQLADKVRRLKKKYENNAGK---GKKYNPTKPHELKAFELSKKI 281
                     579********************************************************************...99999**************** PP

          DUF573  96 Wg 97 
                     Wg
  XP_015886154.1 282 WG 283
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.0E-34192283IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MAPKRPSPLD EPPAASSSEE EDASSGEEEE EEEASGSESG SEEEEEETED PKTSVLPSNH  60
AADKKAPSKK ADPAAANSKP HSSSTGSESE TESGSDTEPE NTRRPTGAAD PNVKPIASKP  120
MEETSTAKKP RSKSNATPAA RLPAKRPSGE SEAKESKRAK KKGQEPEDED EPGTASVAEE  180
EQKKPGDEKK LFQRLWSEDD EIVILRGMID YTAKKGADPS ADMNAFHDFI KKSLQINVTK  240
AQLADKVRRL KKKYENNAGK GKKYNPTKPH ELKAFELSKK IWGGEGPSGG GGDEPKSNGK  300
VRSNQKSNRS LALLKAELLS TPEPPKEAEK MEIDGNPGVS ESLNEVVEFG KSLAVVGLPE  360
HVVKKGLDLI SGSKKAELEE KWKKLHVAEL ELYAKRTQLI SEQAKLILDA YKRSSDH
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015886154.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015886154.10.0probable transcription factor At1g61730
TrEMBLM5WQU91e-124M5WQU9_PRUPE; Uncharacterized protein
STRINGXP_008228265.11e-126(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-33DNA-binding storekeeper protein-related transcriptional regulator