PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015885101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HD-ZIP
Protein Properties Length: 288aa    MW: 31701.5 Da    PI: 7.4744
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015885101.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.5e-19137191256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq  +Le+ F+k+ +++ ++++eLA++l+L  rqV vWFqNrRa+ k
  XP_015885101.1 137 RKKLRLTKEQSATLEDSFKKHTTLNPKQKQELARQLNLRPRQVEVWFQNRRARTK 191
                     78889************************************************98 PP

2HD-ZIP_I/II123.59.9e-40137225189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rl+keq+++LE+sF+++++L+p++K+elar+L+l+prqv+vWFqnrRARtk+kq+E d+e Lk+++++l+een+rL+ke +eL++
  XP_015885101.1 137 RKKLRLTKEQSATLEDSFKKHTTLNPKQKQELARQLNLRPRQVEVWFQNRRARTKLKQTEADCELLKKCCETLTEENNRLKKELQELKA 225
                     69*************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.864133193IPR001356Homeobox domain
SMARTSM003898.1E-18135197IPR001356Homeobox domain
SuperFamilySSF466897.27E-19135201IPR009057Homeodomain-like
CDDcd000861.70E-17136194No hitNo description
PfamPF000468.4E-17137191IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-18137191IPR009057Homeodomain-like
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
SMARTSM003403.6E-21193236IPR003106Leucine zipper, homeobox-associated
PfamPF021831.6E-8193226IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDLDDGCEIG LGLGLVSRNF QQYSDDHHHQ NKKRQLSLKY DHLVPSLTLG PSPKAYQPAA  60
APKIEPSTRV GPYAGESAAD LQPQASSFSG VSSFSNSSSV KRDRDLAGEE VEAEAEVERV  120
SSRISITDQE DEEGSPRKKL RLTKEQSATL EDSFKKHTTL NPKQKQELAR QLNLRPRQVE  180
VWFQNRRART KLKQTEADCE LLKKCCETLT EENNRLKKEL QELKASKLTP PVYMHLPTAT  240
LSMCPSCERI CAGSTGGGGG DDGTSSAPFS IGGKPHFFSP FTHPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185193RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015885101.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015885101.10.0homeobox-leucine zipper protein HAT22-like
SwissprotP466045e-85HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A2C9VXJ51e-105A0A2C9VXJ5_MANES; Uncharacterized protein
STRINGcassava4.1_026976m1e-106(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-82HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]