PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015884549.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 250aa    MW: 28303.2 Da    PI: 7.5474
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015884549.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260109.82e-34161142100
          DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                     CaaC+++r++C++dC+lapyfp++++++f n++klFG +n+lkl+k+l++ ++++am+s++++A+ ra dPv G++++il+l+  ++   +el++
  XP_015884549.1  16 CAACRYQRKRCPPDCPLAPYFPSNRENDFHNARKLFGINNMLKLIKNLDPPNKHIAMKSIIFQANKRALDPVGGCHRIILDLELLIQAYTSELQH 110
                     *****************************************************************************************999998 PP

          DUF260  97 lkee 100
                     + ++
  XP_015884549.1 111 VLHK 114
                     7665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.58314115IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-3216110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MRNTANSKNR KLETVCAACR YQRKRCPPDC PLAPYFPSNR ENDFHNARKL FGINNMLKLI  60
KNLDPPNKHI AMKSIIFQAN KRALDPVGGC HRIILDLELL IQAYTSELQH VLHKLDLCRK  120
KALSGPFPMP PSCGYPLQPP VGTHHQALPY NNNNLQQQHT DTCLPFGFLQ PVEEEHGLQE  180
NYYFGVDVVL NDGEAVSVVD WKVKEEKQTD FNLDPVGENN QTHRLHSTGT IQSSDKAVSE  240
EDVNATLQKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884549.10.0PREDICTED: LOB domain-containing protein 7-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-34LOB domain-containing protein 22