PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015884123.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Nin-like
Protein Properties Length: 906aa    MW: 100885 Da    PI: 6.2413
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015884123.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.9e-29591642152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek+i+l++l++yF++++kdAAk++gvc T+LKriCRq+GIkRWP+Rkik++
  XP_015884123.1 591 AEKTITLQVLRQYFAGSLKDAAKSIGVCSTTLKRICRQHGIKRWPSRKIKKV 642
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.768581662IPR003035RWP-RK domain
PfamPF020426.7E-25594642IPR003035RWP-RK domain
SuperFamilySSF542772.7E-23805901No hitNo description
SMARTSM006661.4E-27814898IPR000270PB1 domain
PROSITE profilePS5174526.947814898IPR000270PB1 domain
PfamPF005647.2E-20816897IPR000270PB1 domain
CDDcd064071.53E-39816896No hitNo description
Gene3DG3DSA:3.10.20.2409.9E-22816897No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 906 aa     Download sequence    Send to blast
MDDSVLSPAL VLGAPSDTAM DLDFMDELFL EGCWLETTDG SGFLNQSPPG SNALFDPLFV  60
WPSSETNSEL GTNPSKRSNQ DERHKASFNE PVERGPLATE SSPQTMIDVA GCSDGLEDQT  120
FQVCEPGRRW WIGPKASPGP ASSVVERLVG ALALIKDVIK DKNSLVQIWV PVHREGRHVL  180
TTNNLPCAVY PSCHKLARYR DISVNYEFSA EEDSEELVMG LPGRVFSRKV PEWTPDVRFF  240
RNEEYPRVSH AQQNDVCGTL ALPIFEKGSR NCLGVVEVVL TTQKIKYRSE LESVCEALEA  300
VDLRSSEILN RNVKVRNMYC QASLPEIQEV LRSACETHRL PLAQTWVPCI QQAKDGSRHS  360
DDNYTWCVST VDHACHVADL HFRAFHEACS EHHLLKGQGI VGEAFMTNKP CFSDDIASIS  420
KTKYPLSHHA RMFGLRSAVA IRLRSIHADV ADFVLELFLP VDCTDPEEQK KMLTSLSLII  480
QQFCRSLRVI TDEELEEESE FPVSEVTVPS NSRPGTTASL TEVRQGGTAI SLFPKEKPME  540
DSGEKLSKLG QLQKDSNNKT VEYAGDCYTI GEGSCSSLGV GKTSEKRRTK AEKTITLQVL  600
RQYFAGSLKD AAKSIGVCST TLKRICRQHG IKRWPSRKIK KVGHSLQKLQ LVIDSVQGAS  660
GAFQIDSFYT NFPELASPNL SGSDPFSTSK RDHPKPTNMQ PEGGMFSSQA TASKSSSSCS  720
QSSSSSQSCS SRSQQQPRMS NVAGNEDLMV GENFGDGMLK RVRSEAELHA STVDVSKPLQ  780
RSRSHKSLSD HHQKENVPTL PRDNSRGSQV VGDFQRVKVT YGDEKTRFRM HNSWGVKELV  840
QEISRRFDIE DMDQFDIKYL DDDSEWVLLT CDADLEECIE IYRSSSESNT IKLSLHVSRH  900
HLRGPS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015884123.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884122.10.0protein NLP4-like
RefseqXP_015884123.10.0protein NLP4-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A221I0P50.0A0A221I0P5_TREOI; NIN-like transcription factor
STRINGEMJ116960.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein