PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015883701.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family G2-like
Protein Properties Length: 451aa    MW: 50295.2 Da    PI: 6.6308
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015883701.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32256309255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  XP_015883701.1 256 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 309
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.51E-15253310IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28254310IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23256309IPR006447Myb domain, plants
PfamPF002496.8E-7257308IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MPQKEGIFDV HLSLNRIPDL SLHISPPNSA PSSICTGTTN EGESGNFDVW QRGDEEEGNN  60
NLKSHSDSSI RASDPLADTE LSLANPSALE AESPWRRNYF SSREVVDPEV QHRHVNHGIS  120
IPDVSEKLKP IKGIPVYNAY GSFPPFSSSS SSRRDSKFCF YEMPPYSSSS SSEAPFRSYG  180
YGTSTTGGFE HMPPRFNGIT MESLRPISQP FQYLDHLHQY NNNNHYGIGA AASDFSNGFR  240
SRFMPKFQNK RNMRAPRMRW TSSLHARFVH AVELLGGHER ATPKSVLELM DVKDLTLAHV  300
KSHLQMYRTV KNTDKPVASS DGSGEDDILS TTTTTTTPQY ENAECLLVNH RGTSTSNNGT  360
LNLEHDLVHS NSNNLWTNSS SKGAWLQANS RDSDELMPEI LSSRQRTTNQ FEGNSWAQSK  420
SFVESSNLGH VNPSLEFSLG RPDWHNKGSH D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-17257311357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-17257311357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-17257311357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-17257311357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-17257311458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015883701.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883701.10.0transcription repressor KAN1-like isoform X1
TrEMBLA0A2I4G0251e-135A0A2I4G025_JUGRE; transcription repressor KAN1-like
STRINGEOY214941e-133(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-54G2-like family protein