PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015883470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Nin-like
Protein Properties Length: 315aa    MW: 36031.7 Da    PI: 4.6869
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015883470.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.31.1e-26147197252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     +k +s e +s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  XP_015883470.1 147 SKALSREIISQYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLMSL 197
                     6899********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.985128217IPR003035RWP-RK domain
PfamPF020429.4E-22150197IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MAPYQSLIEY CWPKYEKVAK DIGNPFHFPT TQYTTPFDLS SGLGGAGFFP LDCQFELPLQ  60
EDNILLDAVP LMECLPTDPL YTALDFKSMG PNIIQDDIFY DDHHGNSLGV YQDVFVGDGQ  120
NNENVLGEER RIIKRCRSSE EKSSSASKAL SREIISQYFY MPITQAAKEL NVGLTLLKKR  180
CRELGIRRWP HRKLMSLQTL IKNVQELGKE EGEENESKLK DAIELLEREK RLMEELPDMQ  240
LEDNTKRLRQ ACFKANYKKR RLMGMMENSK APSLICSNPA NSTTYGNGDN DDDQEELRSL  300
LSDSFSSTDM AFDFN
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015883470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021287140.12e-87protein RKD1
TrEMBLA0A2P5F7337e-97A0A2P5F733_TREOI; RWP-RK domain containing protein
STRINGevm.model.supercontig_423.75e-85(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-40RWP-RK domain-containing protein