PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015883292.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family SBP
Protein Properties Length: 554aa    MW: 60693 Da    PI: 7.9108
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015883292.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.5e-42172247277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv gC++dls+ k+yh+rhkvCe hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  XP_015883292.1 172 CQVYGCNKDLSSSKDYHKRHKVCELHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDNGKRSCRKRLAGHNERRRKPQ 247
                     **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-33166233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.257169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-39170249IPR004333Transcription factor, SBP-box
PfamPF031106.4E-32172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MESWTYVSEG KGFVSEETIS TFNSLARSKN AVLGWELKTP CTFGNNMLVP SQQDIENHGF  60
GEYIEMIGKP LPSDSIGGVL SSKVCVGKNV NHTMTNTFSG EEESSSKLSS SILDSNSKDS  120
SLIDLKLGRI TDHRDIHTSK FSKGAPVLSS LESSTPPKRM RISGLHSQTA FCQVYGCNKD  180
LSSSKDYHKR HKVCELHSKT AKVIVNGIEQ RFCQQCSRFH LLAEFDNGKR SCRKRLAGHN  240
ERRRKPQMGI HSGRAGRLLQ SYSGSRFQGT TLSTTSFICQ DILPGGFLHP DKYGTNDWCR  300
SIKVEDGHDY RPLSSLMVTN GHHRSKSLFP PYDIEKHFPP FNESGANAAT GSIFSENSSQ  360
YPHDLGCPNS GPRSFLHNNT LGNEDFNFFN TATNIQGFSL GISGSGCALS LLSSQSQNPS  420
SHSAEIPIAR PVVMPGNHTC YGMSQVSEKI IGACSQAPIS AVSNKLPSLG MNTVNGNNLS  480
PMLISNASDT VNFDITDGIF QGSDFVNSKD RLSCADGPTI DLLQLSSQLQ RVEDQRQSLQ  540
MKQENDAFCC LRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-291712451084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015883292.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819321e-52LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132661e-52LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883292.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2P5EBT10.0A0A2P5EBT1_TREOI; SBP-box transcription factor
STRINGEMJ102990.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-49SBP family protein