PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881992.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRF
Protein Properties Length: 226aa    MW: 25214.9 Da    PI: 9.889
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881992.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.9e-24125165141
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrk 41 
                     daep+rCrRtDGKkWRCs+++l+++k+CErH+hrgr+rsr+
  XP_015881992.1 125 DAEPWRCRRTDGKKWRCSKEALPDQKYCERHVHRGRHRSRS 165
                     79*************************************97 PP

2QLQ46.88.9e-175490137
             QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    saFT  Qlq+L  Q l+yKy+ a++PvP +L+++i+k
  XP_015881992.1 54 SAFTFLQLQELQLQSLIYKYMEAGLPVPYHLVLPIWK 90
                    79*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-55490IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.3945590IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.0E-125589IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.918125169IPR014977WRC domain
PfamPF088793.7E-20126165IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEFQNRASNF AILSDPWNMN TNGLAQEERS KPPVGLNLEL GCGSNPKRDS IKCSAFTFLQ  60
LQELQLQSLI YKYMEAGLPV PYHLVLPIWK SCSGSLGILN GGMPPNHPCC LGISPLYLDS  120
KKAMDAEPWR CRRTDGKKWR CSKEALPDQK YCERHVHRGR HRSRSVSQRT TPNTATAGGV  180
FGSNTNISIA LPLSRPNTTN TILFPRLGFI TKGVNHADTR KTEPFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881992.11e-170PREDICTED: growth-regulating factor 10-like
SwissprotQ6AWX71e-39GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLF6HUK88e-67F6HUK8_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g04910.t012e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-18growth-regulating factor 2