PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881621.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family WRKY
Protein Properties Length: 758aa    MW: 82009.1 Da    PI: 5.7118
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881621.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1023.4e-32327384260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ +++++ei+Y+g+Hnh+k
  XP_015881621.1 327 EDGYNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSH-EGHITEIIYKGTHNHPK 384
                     7****************************************.***************85 PP

2WRKY102.23e-32541599159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ldDgy+WrKYGqK+vkg+++prsYY+Ct +gC+v+k+ver+++d k v++tYeg+Hnh+
  XP_015881621.1 541 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNTGCTVRKHVERASHDLKSVITTYEGKHNHD 599
                     59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.388321385IPR003657WRKY domain
SuperFamilySSF1182901.96E-25324385IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.7E-28325385IPR003657WRKY domain
SMARTSM007741.2E-35326384IPR003657WRKY domain
PfamPF031067.4E-25327383IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-36526601IPR003657WRKY domain
SuperFamilySSF1182902.09E-28533601IPR003657WRKY domain
PROSITE profilePS5081138.159536601IPR003657WRKY domain
SMARTSM007742.1E-37541600IPR003657WRKY domain
PfamPF031061.0E-24542599IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0009942Biological Processlongitudinal axis specification
GO:0030010Biological Processestablishment of cell polarity
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MAGIDDNVAI IGDWLPPSPS PRAFFSAMLG DNVGSRPILE PAGFNKTEEL FLGPREDTVS  60
RDASIKDASQ DSDSGNQLTE VGSYSEQKSN SRIGLVERIA ARAGFNAPRL NTESIRSSDL  120
SLTSDVRSPY LTIPPGLSPT TLLDSPVFLS NSLAQPSPTT GKFSFIANGN NRNPTLIFET  180
PDKTRDSFFE DINGSSFAFK PIAESGSTFF LGARSKMTSV GIPQPSFPNI EMSVQSENSP  240
QSMEPTEVQN QKKNNLQLQA DFSKSSVDKD SGTNTIPAAA GAADEKAMDN VGGNTEHSPP  300
LDEQPDEEGD QRGGDSIAGG SGGTTSEDGY NWRKYGQKQV KGSEYPRSYY KCTHPNCQVK  360
KKVERSHEGH ITEIIYKGTH NHPKPPPNRR SALGSSNLLI DMRLDIPEQA GGGPQNGGDG  420
DPVWASTEKT TVDWRHDNLE VTSSASMGPG YCNQSTSFQA QNGTQLESGD AVDASSTFSN  480
DEDDDDRGTH GSVSLGYDGE EDESESKRRK IEAYATEMSG ATRAIREPRV VVQTTSEVDI  540
LDDGYRWRKY GQKVVKGNPN PRSYYKCTNT GCTVRKHVER ASHDLKSVIT TYEGKHNHDV  600
PAARNSSHVN SGNVAAQASS VHRPEPSHSQ AHNGMPRFER PGAASLASFS LPASASARQQ  660
QQQQQLGPTH GGGFSFEMNH QAGLANLAMA GLGPGQPKLA VLPVHPYLAQ QQRHMNEMGF  720
MFPKGEPKVE PISEPTLNLS NASVYQQFMS RLPLGPQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-36324602878Probable WRKY transcription factor 4
2lex_A1e-36324602878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00071PBMTransfer from AT5G56270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881614.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_015881621.10.0PREDICTED: probable WRKY transcription factor 2
SwissprotQ9FG770.0WRKY2_ARATH; Probable WRKY transcription factor 2
TrEMBLM5W2N00.0M5W2N0_PRUPE; Uncharacterized protein
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.10.0WRKY DNA-binding protein 2