PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881063.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GeBP
Protein Properties Length: 371aa    MW: 42613.9 Da    PI: 6.4583
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881063.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573104.86.9e-33126218497
          DUF573   4 qrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     +rlw+++Dei++L G+i+++ k+g++p +d  afyef+k+ i+++vsk+ql+eKirrLKkK+k + +k   + + +f ++h++ if+l kkiW+
  XP_015881063.1 126 NRLWNQDDEIAILNGMIEYRFKKGSDPNADYIAFYEFLKNTIQANVSKNQLMEKIRRLKKKYKINAQK-TLDGDHVFPNPHEKIIFDLGKKIWE 218
                     79*****************************************************************9.666677******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.9E-28126218IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSPKCLFASD HEDDDEKELE YDTSSTMKKC SSSSKISKPQ SPSHGDSEHK TDSESESCNT  60
YGSPSASDFT IKPIVSKPTS MEDSSKPKMK NKAHPTAEPE HKQSVKDSKK RKVSDDVDAK  120
KGSGLNRLWN QDDEIAILNG MIEYRFKKGS DPNADYIAFY EFLKNTIQAN VSKNQLMEKI  180
RRLKKKYKIN AQKTLDGDHV FPNPHEKIIF DLGKKIWETS VYDNDDGIKC NGTLRQSNGG  240
DKDEAEDVVE KKNDENGEME KNQTEEFWSN HPSLNESLRL MKCVPGSEWI VNATKRILPL  300
IEKSRVKELE DRWSKLHLEE IALYLHKIEL IQEQGNVVEM IHHETLESEP LLFLHEKPRK  360
SIFRFIFFKS S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881063.10.0PREDICTED: uncharacterized protein LOC107417022
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.16e-25DNA-binding storekeeper protein-related transcriptional regulator