PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015880028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family M-type_MADS
Protein Properties Length: 346aa    MW: 39642.8 Da    PI: 7.8597
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015880028.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.82.5e-17445344
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    i ++  r++tf kR+ g+lKK +E S+LC+++v++ii+++++
  XP_015880028.1  4 IADEKSRKITFQKRKRGMLKKCYEFSILCGIDVCMIIYGPKQ 45
                    788999*********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554554.32E-16190IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-8151IPR002100Transcription factor, MADS-box
CDDcd002662.65E-18143No hitNo description
PROSITE profilePS5006615.418144IPR002100Transcription factor, MADS-box
PfamPF003192.3E-17444IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MELIADEKSR KITFQKRKRG MLKKCYEFSI LCGIDVCMII YGPKQIERPT ELIIYPDDST  60
QVACIIKQLQ TTTIYKPPKR IFNLSDIFID RKRKIDTEIT KLRKVYFATK YPISDELINS  120
LSRDQLNFLL SRLDTKIEDA KAMIDLHKEN DLLLMKNPVG QNCANHVQNI FHDQKPAIPL  180
NHHHHHHPVV DHMQLPLQVL LNRTTPPPKM VPPPCFDSNP NPAINIAMKN PLTMMMLMND  240
QAGLENGASS SNIIDNHQFI SSSSNNHLCG PVFNDPTLGM IDNMMFSNMG GQYSQLVQVQ  300
QPMPYIQYNQ TVNAAAGIHS QRIYGSDEGN RFDDEFSEFL YKNKIL
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015880028.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015880028.10.0MADS-box protein FBP24-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-18AGAMOUS-like 82