PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015879984.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family SBP
Protein Properties Length: 1059aa    MW: 117174 Da    PI: 8.4968
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015879984.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.61.1e-40149226178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCe hsk++++lv++++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+q+
  XP_015879984.1 149 MCQVDNCKEDLSNAKDYHRRHKVCELHSKSTKALVAKQMQRFCQQCSRFHPLTEFDEGKRSCRRRLAGHNRRRRKTQP 226
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.0E-34142211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.778147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-37148228IPR004333Transcription factor, SBP-box
PfamPF031102.7E-29150223IPR004333Transcription factor, SBP-box
SuperFamilySSF484035.86E-5862959IPR020683Ankyrin repeat-containing domain
CDDcd002041.76E-4862956No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1059 aa     Download sequence    Send to blast
MEEVAQVASP IFIHQTLSSR YCDAPAMARK RDLLYQTPNF QQQRFANPGD SWSPKVWEWD  60
SLRFLAKPVD AEALRLGSST AATPEQKKRG EVSSGSGSGS GSTLKKNSAG EDDDSLRLNL  120
GGGLACVEEP VSRPNKRVRS GSPGATYPMC QVDNCKEDLS NAKDYHRRHK VCELHSKSTK  180
ALVAKQMQRF CQQCSRFHPL TEFDEGKRSC RRRLAGHNRR RRKTQPEDVT SRLVLPGERD  240
NKSNGHLELF NLLAAVARAQ GKNEDKSINA SLPDREQLLQ ILTKINSLPL PVDLAAKLPN  300
LGSLNRKLSE QTALDHQVLL KGRSSPSTMD LLTVLSATLK SSAPDALPVV SQRSSQSSDS  360
EKTKLNCPDQ ATCPNLQKRP QEFPSVGGER SSTSYQSPME DSDCQVQETR VNLPLQLFAS  420
PSENDSMPKL ASSRKYFSSD SSNPIEERSP SSSPPVVQKL FPMQTMAEAV KSEKTSIGRE  480
VNATVDSSRS HGCNMPFDLF RGADTGSIQS FPYQAGYTSS GSDHSPSSLN SDAQDRTGRI  540
IFKLFDKDPS HFPATLRAQI YNWLSNSPSE MESYIRPGCV VLSIYVSMPS VAWEQLQENL  600
LQSISSLVQS SDSDFWRNGR FLVHAGRHLA SYKDGKFRLR KSWRTWNSPE LISVSPLAVV  660
GGQETSLVLK GRNLSNLGTE IHCTCMGGGY TSKKIMGSTY HGTMYEEINL GGFRVQDASP  720
GVLGRFFIEV ENGFKGNSFP VIVADASICD ELRVLESVFD GEGKLCDIIS EDQNHDYGSP  780
RSKEEAIHFL NELGWLFQRK RTSSLLNGPD YSLGRFKFLL TFSVERNCSA LVKTVLDILV  840
ERNLHETGLS RESVEMLTEI QPLNRAVKRR CRKMVDLLVH YFVIGSGDTS KRYIFPPNIA  900
GPGGITPLHL AACMSGSDDV VDALTNDPQE IGLNCWNNLL DANRQSPHAY ALMTNNQSYN  960
KLVTRKLAHR RKDQVTVTIE NDTSTELKQG GRSCARCAVA ATKYSRRVPG SQGLLTRPYI  1020
HSMLAIAAVC VCVCLFLRGS PDIGLVAPFK WENLDFGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-30140223384squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1864869RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015879984.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867006.10.0squamosa promoter-binding-like protein 14
RefseqXP_015879984.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A251P2S50.0A0A251P2S5_PRUPE; Uncharacterized protein
STRINGXP_008237887.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]