PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015879435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HD-ZIP
Protein Properties Length: 295aa    MW: 33593.3 Da    PI: 6.802
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015879435.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-1886138456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe+ +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  XP_015879435.1  86 KKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 138
                     4568889*********************************************9 PP

2HD-ZIP_I/II129.61.2e-4184176193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekk+rl+ eqvk+LE+sFe+ +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lk+++dal+++n++L +++++L++el++
  XP_015879435.1  84 EKKKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQFDALRSDNDALLAQNKKLHAELST 176
                     69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-1976142IPR009057Homeodomain-like
PROSITE profilePS5007117.02280140IPR001356Homeobox domain
SMARTSM003891.2E-1783144IPR001356Homeobox domain
CDDcd000865.96E-1685141No hitNo description
PfamPF000461.6E-1586138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-1988147IPR009057Homeodomain-like
PRINTSPR000311.1E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5120136IPR000047Helix-turn-helix motif
PfamPF021836.2E-16140180IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAFQPHSFMF QAHEDHQDLH LSSSASLNTL HFHAGGGHGA MPFMMKRSLS FSGVHNHHEN  60
IEQCEEVHGG GDDDLSDDGS QIGEKKKRLN LEQVKTLEKS FEMGNKLEPE RKMQLAKALG  120
LQPRQIAIWF QNRRARWKTK QLEKDYEVLK KQFDALRSDN DALLAQNKKL HAELSTLKGR  180
DSNEAGLSNL KKENEGSWSN GSENSSDINL EISRTPVINS PASSQINGKN FFPSTLRPSS  240
ITQFLQGTSR SDIQGLKVDQ HHHHQMVQEE SFCNMFNGIE DQQGFWPWPE QHQFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015879435.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879435.10.0homeobox-leucine zipper protein ATHB-20-like
SwissprotQ8LAT09e-85ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLA0A251Q6381e-142A0A251Q638_PRUPE; Uncharacterized protein
STRINGEMJ174831e-142(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.12e-76homeobox protein 20