PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015877999.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HD-ZIP
Protein Properties Length: 822aa    MW: 88468.7 Da    PI: 6.5569
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015877999.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.9e-21129184156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++k +++t++q++eLe++F+++++p++++r eL+k+l+L+ +qVk+WFqNrR+++k
  XP_015877999.1 129 KKKYHRHTPNQIQELEAFFKECPHPDEKQRLELSKRLNLENKQVKFWFQNRRTQMK 184
                     79999************************************************999 PP

2START123.23.4e-393415282169
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     la++a++el+k+a+ + p+W kss    e +n +e+l+++ +  +        +ea r+s +v+ +   lve+l+d + +W e+++    +a+t+
  XP_015877999.1 341 LALAAMDELLKMAQPDTPLWIKSSeggkETLNHEEYLRTVFSPCFgmkpsgVVTEATRDSCMVIINGLALVETLMDAN-RWVEMFPclvaRASTI 434
                     6899**********************999999****99995544488888889*************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                     + is+g      galq+m aelq+lsplvp R   f+R+++q+ +g+w++vdvS+d++q+  +++ +  +++lpSg+++++++ng+sk  +++ 
  XP_015877999.1 435 DLISTGmggtrnGALQVMHAELQVLSPLVPvRPLKFLRFCKQQAEGVWAVVDVSIDVNQEGINEHTFLHCRRLPSGCVVQDMPNGYSKGNILSF 528
                     *************************************************************99************************9777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-22113180IPR009057Homeodomain-like
SuperFamilySSF466891.21E-20115186IPR009057Homeodomain-like
PROSITE profilePS5007117.637126186IPR001356Homeobox domain
SMARTSM003899.9E-19128190IPR001356Homeobox domain
PfamPF000469.3E-19129184IPR001356Homeobox domain
CDDcd000869.46E-20129186No hitNo description
PROSITE patternPS000270161184IPR017970Homeobox, conserved site
PROSITE profilePS5084827.054331522IPR002913START domain
SuperFamilySSF559618.38E-21332522No hitNo description
CDDcd088751.19E-85335522No hitNo description
SMARTSM002341.6E-18340591IPR002913START domain
PfamPF018523.4E-32341528IPR002913START domain
SuperFamilySSF559613.71E-19567747No hitNo description
SuperFamilySSF559613.71E-19777806No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 822 aa     Download sequence    Send to blast
MSFGGLLTST SSGNSGGGGG GGRVVAGISP HTNNNNNNTT TYMPSGAIAQ PLFLSPPISM  60
QSSSSTLSLS LQQRNMDGHG EIGLLAENFD PGIVGRMRDD GYESRSGSDN FEGASGDDQD  120
GGDEQPPRKK KYHRHTPNQI QELEAFFKEC PHPDEKQRLE LSKRLNLENK QVKFWFQNRR  180
TQMKTQLERH ENIILRQEND KLRAENSMMK DAMANPVCNQ CGGPAIPGQI SFEEHQLRIE  240
NARLKDELNR ICALANKFLG RPLSSLATPI PIPSSTASGL QLAVGRNGMG GLNPSSANAL  300
PMGLDLGDGI ASSSSMMPSM KSSMGMMGNE MPFGRSMFVD LALAAMDELL KMAQPDTPLW  360
IKSSEGGKET LNHEEYLRTV FSPCFGMKPS GVVTEATRDS CMVIINGLAL VETLMDANRW  420
VEMFPCLVAR ASTIDLISTG MGGTRNGALQ VMHAELQVLS PLVPVRPLKF LRFCKQQAEG  480
VWAVVDVSID VNQEGINEHT FLHCRRLPSG CVVQDMPNGY SKGNILSFSE HFLLKILLLY  540
KKFVRGLFAI LMSSTVNSSE DHTAINPGGR RSMLKLAQRM VDNFCTGVCA STVGKWDKLH  600
VGNVGEDVKV MTRKSVDDPG EPPGIVLSAA TSVWIPVPQQ RLFDFLRNER LRSEWDILSN  660
GGPMQEMIHI AKGQGHGNCV SLLRASAINA SESTMLILQE TWSDASCSLV VYAPVDTASI  720
NVVMHGGESA YVALLPSGFA ILPDGRSSGI GGSTSYNGSS NKGQGDGGSG GGGDGGGSLL  780
TVGFQILVNS LPSAKLTVES VETVNNLISC TIEKIKAALQ VS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015877999.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877999.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2P5BPU30.0A0A2P5BPU3_PARAD; Octamer-binding transcription factor
STRINGXP_010107411.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]