PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015877527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 231aa    MW: 25123.5 Da    PI: 8.949
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015877527.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.7e-42441431100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael+
  XP_015877527.1  44 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQTLQAELN 138
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_015877527.1 139 AVRAE 143
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81343144IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-4244141IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKRESD AAAATQMGRR HMLGPPGTLN TITPCAACKL LRRRCAQECP  60
FSPYFSPHEP QKFASVHKVF GASNVSKMLM EVPESQRADA ANSLVYEANV RLRDPVYGCM  120
GAISALQQQV QTLQAELNAV RAEILKYKYR EANIIPSSSS TLPHHHHHHH LALLSSSGAV  180
SVAAPPPAPP PPLPPSLPPP PTSSSSSSLY TQPANAADYN TISSENVSYF G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877527.11e-170PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T51e-90LBD15_ARATH; LOB domain-containing protein 15
TrEMBLD7T4G01e-123D7T4G0_VITVI; Putative uncharacterized protein
STRINGVIT_13s0067g02380.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-88LOB domain-containing protein 15