PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015877452.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 184aa    MW: 20732.4 Da    PI: 6.4985
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015877452.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.53.1e-4561051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la
  XP_015877452.1   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVSSIVYEANARMRDPVYGCVGAISYLQNQVSQLQMQLA 100
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_015877452.1 101 VAQAE 105
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8615106IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-446103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPVHQRA  60
DAVSSIVYEA NARMRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQQEPNNIVV  120
QNPQIEQDPP DHHHHNDIID EEKSYHLQNN VNLPHQYLNF ASSSSNVIHD SLKRESIFGY  180
DMVS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015877452.11e-135PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW31e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A067FN821e-101A0A067FN82_CITSI; Uncharacterized protein
TrEMBLV4TH271e-101V4TH27_9R
STRINGPOPTR_0010s19180.16e-92(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-77LBD family protein