PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874380.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LBD
Protein Properties Length: 216aa    MW: 23315.5 Da    PI: 6.083
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874380.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.6e-42501491100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la
  XP_015874380.1  50 PCAACKILRRRCADKCVLAPYFPPTEPTKFTIAHRVFGASNIIKLLQELPESQRADAVTSMVYEAGARIRDPVYGCAGAICQLQKQVNELQAQLA 144
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_015874380.1 145 KAQAE 149
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.01149150IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4250147IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MNMDYSSDAN TTTITNTSSL SPSSSSSPPP PPHPPPPSSP PSPPPVVVSP CAACKILRRR  60
CADKCVLAPY FPPTEPTKFT IAHRVFGASN IIKLLQELPE SQRADAVTSM VYEAGARIRD  120
PVYGCAGAIC QLQKQVNELQ AQLAKAQAEV VNMQCQHANL VALICMEMAQ SQQGLPQQTL  180
ADSFIATSPH SNQTNMGFLE DNNNNNIGPL WETLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874380.11e-159PREDICTED: LOB domain-containing protein 11-like
SwissprotQ9SK082e-76LBD11_ARATH; LOB domain-containing protein 11
TrEMBLM5W0701e-96M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA13G40370.22e-95(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-67LOB domain-containing protein 11