PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015873006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GATA
Protein Properties Length: 332aa    MW: 36225.5 Da    PI: 5.2853
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015873006.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.4e-18252286135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     Cs+Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  XP_015873006.1 252 CSHCGVQKTPQWRTGPLGAKTLCNACGVRYKSGRL 286
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.2E-915327IPR016679Transcription factor, GATA, plant
SuperFamilySSF577161.19E-14245308No hitNo description
SMARTSM004011.6E-16246300IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.912246282IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-14250284IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.45E-14251299No hitNo description
PfamPF003201.8E-16252286IPR000679Zinc finger, GATA-type
PROSITE patternPS003440252277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MELVETALKT SISKEMLMKP SPQAFLDDLW VASGQNGVAC DDFFVDDLLD LSNEDGLVDQ  60
EPEEEEEKVS VSVSTIKEHQ EEQENLNPST SFSPKDDFGS LPTSGLSVPA DDLADLEWLS  120
HFVEDSFSEF SVPYPTGILT EKHNNQTEKG PEPQIPISVN SCFKIPVPAK ARSKRTRTGG  180
RIWSLGSPSF TESSSSSTSS CSSSSPSSPL LIYTTQSIEP VGSVEKPPAK KPKKKPSVDS  240
SGGVSVQPPR RCSHCGVQKT PQWRTGPLGA KTLCNACGVR YKSGRLLPEY RPACSPTFSS  300
EIHSNHHRKV LEMRRKKETT ESGLAPPDVP NF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015873006.10.0PREDICTED: GATA transcription factor 5
SwissprotQ9FH571e-99GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI31e-132M5WGI3_PRUPE; Uncharacterized protein
STRINGVIT_04s0023g02880.t011e-122(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.16e-50GATA transcription factor 7