PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015872939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRF
Protein Properties Length: 242aa    MW: 26368.5 Da    PI: 10.0338
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015872939.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.7e-25165208144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  XP_015872939.1 165 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 208
                     79****************************************98 PP

2QLQ61.22.8e-21103136235
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                     +FT+aQ+ +L++Q+++yKy++a++PvPp+Ll++i
  XP_015872939.1 103 PFTNAQWKELERQAMIYKYMVASVPVPPDLLLPI 136
                     8********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.0E-12102138IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.4E-15103136IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.126103138IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.586165209IPR014977WRC domain
PfamPF088795.5E-21166208IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MRMLHHDNHY RPPSSSSSLR GLGGGDLGPT CNRAPAGPDD IYDVVVVSNA GSHAAAVASA  60
AVSGDAVVRP LQPFDISTTS PSTSSPTTAF KFSGGMAATL GFPFTNAQWK ELERQAMIYK  120
YMVASVPVPP DLLLPINTRN LSAPAASQYS LGSDFSLRLS NNNTDPEPGR CKRTDGKKWR  180
CSRDVAPDQK YCERHMHRGR PRSRKHVEVH VNNNNKRTRH DHHHHHALPT TSSATMAVTN  240
PT
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015872939.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015870430.11e-179growth-regulating factor 8-like
RefseqXP_015870521.11e-179growth-regulating factor 8-like
RefseqXP_015870685.11e-179growth-regulating factor 8-like
RefseqXP_015871942.21e-179growth-regulating factor 8-like
RefseqXP_015871945.11e-179growth-regulating factor 8-like
RefseqXP_015872939.10.0growth-regulating factor 6-like, partial
TrEMBLA0A251QPM74e-81A0A251QPM7_PRUPE; Uncharacterized protein
STRINGXP_008234659.14e-82(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-38growth-regulating factor 7