PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015871696.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family HD-ZIP
Protein Properties Length: 568aa    MW: 62710.6 Da    PI: 6.4675
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015871696.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox664.9e-21141196156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
  XP_015871696.1 141 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLCLETRQVKFWFQNRRTQMK 196
                     688999***********************************************999 PP

2START188.53.3e-593575681192
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++elvk+a+ +ep+W++s     e++n++e+l++f++  +     + +e++r++gvv+ ++  lve+l+d+  +W e+++    + +t+
  XP_015871696.1 357 ELALAAMDELVKMAQTDEPLWMRSLeggrEILNREEYLRTFSPCIGlkpngFVSETSRETGVVIINSLALVETLMDSH-RWAEMFPcviaRTSTT 450
                     5899**************************************99999***9***************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskvtwveh 169
                     +vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +   +s+  +++lpSg+++++++ng+skvtwveh
  XP_015871696.1 451 DVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGaPPSFLHCRRLPSGCVVQDMPNGYSKVTWVEH 545
                     *********************************************************99999999****************************** PP

                     EE--SSXXHHHHHHHHHHHHHHH CS
           START 170 vdlkgrlphwllrslvksglaeg 192
                     ++++++l+h+l+r+l++sg+ +g
  XP_015871696.1 546 AEYDESLVHQLYRPLLSSGMGFG 568
                     ********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-21123198IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.3E-22128198IPR009057Homeodomain-like
PROSITE profilePS5007117.216138198IPR001356Homeobox domain
SMARTSM003891.7E-17139202IPR001356Homeobox domain
CDDcd000863.97E-18140198No hitNo description
PfamPF000461.3E-18141196IPR001356Homeobox domain
PROSITE patternPS000270173196IPR017970Homeobox, conserved site
PROSITE profilePS5084839.526348568IPR002913START domain
SuperFamilySSF559611.37E-28349565No hitNo description
CDDcd088757.38E-117352568No hitNo description
SMARTSM002344.1E-38357568IPR002913START domain
PfamPF018525.5E-51357568IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 568 aa     Download sequence    Send to blast
MSFGGFLENS TGGGGGARIV ADISYTTTST NSPNSNTINN NNNHNMPSTT ALAQPRLVTQ  60
SLTKSMFNSP GLSLALQTNT NIDGQGDHHH HHHQVTRMGE NFETNVGRRS REEEHESRSG  120
SDNMDGGSGD DQDAADNPPR KKRYHRHTPQ QIQELEALFK ECPHPDEKQR LELSRRLCLE  180
TRQVKFWFQN RRTQMKTQLE RHENSLLRQE NDKLRAENMS IRDAMRNPIC SNCGGPAIIG  240
EISLEEQHLR IENARLKDEL ERVCALAGKF LGRPISSLAT SIAPPLPSST LELGVGTNGF  300
GNLSTVATTM PLGPDYGSGG GISGSLTVVP PLQQPPTTTR QAASVLDRSM ERSMFLELAL  360
AAMDELVKMA QTDEPLWMRS LEGGREILNR EEYLRTFSPC IGLKPNGFVS ETSRETGVVI  420
INSLALVETL MDSHRWAEMF PCVIARTSTT DVISSGMGGT RNGALQLMHA ELQVLSPLVP  480
VREVNFLRFC KQHAEGVWAV VDVSIDTIRE TSGAPPSFLH CRRLPSGCVV QDMPNGYSKV  540
TWVEHAEYDE SLVHQLYRPL LSSGMGFG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015871696.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015888672.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2-like
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLM5XQZ70.0M5XQZ7_PRUPE; Uncharacterized protein
STRINGEMJ214550.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.20.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]