PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015870521.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GRF
Protein Properties Length: 603aa    MW: 64648.8 Da    PI: 7.9348
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015870521.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.11.7e-24214257144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  XP_015870521.1 214 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 257
                     79****************************************98 PP

2QLQ59.31.1e-20152185235
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                     +FT+aQ+ +L++Q+++yKy++a++PvPp+Ll++i
  XP_015870521.1 152 PFTNAQWKELERQAMIYKYMVASVPVPPDLLLPI 185
                     8*******************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.0E-12151187IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.126152187IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-14152185IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.586214258IPR014977WRC domain
PfamPF088791.9E-20215257IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MRMEKFCVSD KEAKRNIYNK IGDDLEISAK VHSNSISSST ESLPACNSTM RMLHHDNHYR  60
PPSSSSSLRG LGGGDLGPTC NRAPAGPDDI YDVVVVSNAG SHAAAVASAA VSGDAVVRPL  120
QPFDISTTSP STSSPTTAFK FSGGMAATLG FPFTNAQWKE LERQAMIYKY MVASVPVPPD  180
LLLPINTRNL SAPAASQYSL GSDFSLRLSN NNTDPEPGRC KRTDGKKWRC SRDVAPDQKY  240
CERHMHRGRP RSRKHVEVHV NNNNKRTRHD HHHHHALPTT SSATMAVTNP TVNNNINGSH  300
TQFIGPTSAL PYHQSPVFLD KSTIKASTFD SSLSSEKVST RNLDWMMKAE PAAMTASDPQ  360
WHQLMQTKME LSSKTTSYCD TSNSSVFNQH SEEVPFLNLN SYSNFNTGQD QHESDQCSLF  420
LNPEVVSLEN QTPAVHAVPV APRSFIDAWS NSTIADKSCV SSSAKLSPSS LTLSMGGCNS  480
INEEMSRTHQ IGSGYNVNHS KTHVTSWLTP ASWVAPQPGG PLAEVLRPSS LTGSTTSAVS  540
NPSSPVNNGK GGDSSCSPVA TTVSSPSGVL QKTLASLSDS SGSSSPTVVG CSSSNAKVEI  600
ALL
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015870521.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015870430.10.0growth-regulating factor 8-like
RefseqXP_015870521.10.0growth-regulating factor 8-like
RefseqXP_015870685.10.0growth-regulating factor 8-like
RefseqXP_015871945.10.0growth-regulating factor 8-like
TrEMBLA0A251QPM70.0A0A251QPM7_PRUPE; Uncharacterized protein
STRINGXP_008234659.11e-180(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.16e-37growth-regulating factor 7