PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015868519.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family WRKY
Protein Properties Length: 235aa    MW: 25746.2 Da    PI: 8.6047
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015868519.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.94.8e-34154211259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k+ver+++dp+++++tYeg+Hnhe
  XP_015868519.1 154 SDGFRWRKYGQKVVKGNPYPRSYYRCTSLKCNVRKHVERASDDPRAFITTYEGKHNHE 211
                     7********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.8E-35138213IPR003657WRKY domain
PROSITE profilePS5081135.485148213IPR003657WRKY domain
SuperFamilySSF1182904.71E-29148213IPR003657WRKY domain
SMARTSM007741.3E-38153212IPR003657WRKY domain
PfamPF031067.6E-27155211IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
KKRKHNHLKP QPPRRSSSGM QGLGFVSDAA AIDTNNQLPS SHHVNERNEG SEGRLDNQNE  60
VGLSRHSYQG GKTSQLYDSA ATGGILSAGG TPDNSCGLSG ECEEGSKGLE AEDDEPRSKR  120
RKGENPSNEA GTLGEGIQEP RLVVQNNADT EIFSDGFRWR KYGQKVVKGN PYPRSYYRCT  180
SLKCNVRKHV ERASDDPRAF ITTYEGKHNH EMPLRNSNPV SSEAVTLAPT GKDKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-34144213877Probable WRKY transcription factor 4
2lex_A5e-34144213877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015868519.11e-176PREDICTED: WRKY transcription factor 44-like, partial
TrEMBLM5VZ011e-115M5VZ01_PRUPE; Uncharacterized protein
STRINGVIT_08s0040g03070.t011e-109(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.21e-45WRKY family protein