PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015867959.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family GeBP
Protein Properties Length: 346aa    MW: 39451.1 Da    PI: 5.6878
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015867959.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573109.52.3e-34126218497
          DUF573   4 qrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     +rlw+++Dei++L G+i+++ k+g++p +d +afyefvk+ i+++vsk+ql+eKirrLKkK+k + +k   + + +f ++h++ if+l kkiW+
  XP_015867959.1 126 NRLWNQDDEIAILNGMIEYRFKKGSDPNADYNAFYEFVKNTIQANVSKNQLMEKIRRLKKKYKINAQK-TLDGDHVFPNPHEKIIFDLGKKIWE 218
                     79*****************************************************************9.666677******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.5E-29126218IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MSPKCLFASD HEDDDENELE YDASSTMKKC SFSSKISKPQ SPSHGDSEHK TDSESESCNT  60
YGSPSASDFT IKPIVSKPTS MEDSSKPKMK NKAHPTAEPE HEQSVKDSKK RKVSDDVDAK  120
KGSGLNRLWN QDDEIAILNG MIEYRFKKGS DPNADYNAFY EFVKNTIQAN VSKNQLMEKI  180
RRLKKKYKIN AQKTLDGDHV FPNPHEKIIF DLGKKIWETS VYDNDDGIKC NGTLRQSNGG  240
DKDEAEDVVE KKNDENGEME KNQTEEFWSN HPSLNESLRL MKCVPGSEWI VNATKRILPL  300
IEKSRVKELE DRWSKLHLEE IALYLHKIEL IQEQGKAILD SLKSMD
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015867959.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024924832.10.0STOREKEEPER protein-like isoform X1
RefseqXP_024924833.10.0STOREKEEPER protein-like isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.17e-27DNA-binding storekeeper protein-related transcriptional regulator