PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015867881.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family LFY
Protein Properties Length: 175aa    MW: 19995.8 Da    PI: 9.5812
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015867881.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY391.21.3e-1191158228385
         FLO_LFY 228 qrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnal 322
                     qrehPfivtepgevargkknGLDYLf+LyeqCr+fL+qvq+iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnal
  XP_015867881.1   1 QREHPFIVTEPGEVARGKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNAL 95 
                     8********************************************************************************************** PP

         FLO_LFY 323 rrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                     rra kergenvGawrqacykplvaiaarqgwdid++fnahprLsiWYvPtkLrqLCh+er++a
  XP_015867881.1  96 RRALKERGENVGAWRQACYKPLVAIAARQGWDIDSIFNAHPRLSIWYVPTKLRQLCHAERNNA 158
                     ************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.1E-1161158IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
QREHPFIVTE PGEVARGKKN GLDYLFHLYE QCRDFLIQVQ NIAKERGEKC PTKVTNQVFR  60
YAKKAGASYI NKPKMRHYVH CYALHCLDEE ASNALRRALK ERGENVGAWR QACYKPLVAI  120
AARQGWDIDS IFNAHPRLSI WYVPTKLRQL CHAERNNATL AASSSVSTGA DHLPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-11011576162PROTEIN LEAFY
2vy2_A1e-11011576162PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay regulate indeterminacy during leaf and flower development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015867881.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN1650970.0JN165097.2 Ziziphus jujuba cultivar Jinsi No. 4 LFY mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001310806.11e-130floricaula/leafy homolog
SwissprotO485591e-116UNI_PEA; Protein UNIFOLIATA
TrEMBLG1FCB11e-128G1FCB1_ZIZJJ; LFY
STRINGXP_008392692.11e-120(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80333346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-111floral meristem identity control protein LEAFY (LFY)