PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015866231.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Nin-like
Protein Properties Length: 1000aa    MW: 110583 Da    PI: 4.9531
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015866231.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.72.7e-29602653152
          RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     aek++sl++l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  XP_015866231.1 602 AEKNVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 653
                     589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.87586673IPR003035RWP-RK domain
PfamPF020422.6E-26605653IPR003035RWP-RK domain
SuperFamilySSF542772.35E-22896982No hitNo description
Gene3DG3DSA:3.10.20.2402.3E-25897979No hitNo description
SMARTSM006665.6E-24900982IPR000270PB1 domain
PROSITE profilePS5174522.391900982IPR000270PB1 domain
PfamPF005648.3E-18901981IPR000270PB1 domain
CDDcd064072.47E-31901981No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1000 aa     Download sequence    Send to blast
MEYPISSKEK GIENWASSRA QVESMASFDG GTRNSLAEDM FNNISEFMDF DNYAGWCDSS  60
SAVDQMAASY GLPSYPSVSY APMDAFNFTE QSIGSLPVAE AGGDFNLEKG PLNYGDKTVF  120
QQVDNQYGLS SNSNVANESV TKQSDGSFQQ NNVVDVANSI ISRPPAVSLD EKMLKALSLF  180
KESSGGGILA QVWVPMKHGD QYFLSTCERP YLLDHMLAGY REVSRLYKFS AEGKQGSFPG  240
LPGRVFMSKI PEWTSNVGYY SKTEYLRADH AHNHQVRGSI ALPVFDSEPE VSCCAVLELV  300
TTKEKSNFDS EMEVVCRSLQ AVNLRTSVPP RLLPQCLSEN QKDALAEIVD VLRVVCHAHR  360
LPLALTWIPC CYTEGAGKEN MGLHVREGNK SSNGKSILCI EETACYVNDR AMLDFVRSCV  420
ENYLEEGQGL AGKALQSNVP FFFPDVKTYN IYEYPLVHHA RKFGLNAAVA IRLRSTYTGD  480
EDYILELFLP VNMTGALEQQ LLLNNLSRTM QRICKSLRTV SETQLSGAGF SDIEFQKGSI  540
QNFPIMSRGN SQNALSDSDV NSMEGMILNI PDQKNEGIEA DIPCEQAVGG PRRQMEKKRN  600
TAEKNVSLSV LQQYFSGSLK DAAKSIGVCP TTLKRICRQH GISRWPSRKI NKVNRSLRKI  660
QSVLDSVKGV EGGLKFDPTT GEFMATASVI QDFDTQKNLL FPEKIQSMRN PELITQHAVQ  720
ATTVPFTEGE DFVIKLEEDE YCVGGNIPIQ NSCETESKKL NTPILNSNGS SKPISIDTGS  780
NQPCSFVTRL QNCPENAFLP SYIVKGVKQL SQNKYSMKLE NSDWHFASRS SSSMAAADEM  840
DAGGDDDDGI LEHNQPTSSS MTDSSNGSGS MVNDCSSGSQ GFDEHKHPKG KRNCVDGESK  900
ITVKATYKED TIRFKFEPSA GCFQLYEEVA RRFKLQNGTF QLKYLDDEEE WVMLVSESDL  960
QECLEILDDI GTRTVKFQVR DKPCGLSSSG SSNCFLTGSS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015866231.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015866231.10.0protein NLP9-like
RefseqXP_015866233.10.0protein NLP9-like
RefseqXP_015866234.10.0protein NLP9-like
RefseqXP_015866235.10.0protein NLP9-like
RefseqXP_024924160.10.0protein NLP9-like
RefseqXP_024924161.10.0protein NLP9-like
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLA0A2P5G0I90.0A0A2P5G0I9_TREOI; NIN-like transcription factor
STRINGXP_008237190.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34643465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein
Publications ? help Back to Top
  1. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]