PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015865812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Nin-like
Protein Properties Length: 196aa    MW: 22811.3 Da    PI: 9.0226
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015865812.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.25.2e-2687135452
          RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      ++l+d++k+F+ pi++AAkeL+v+lTvLK++CR+++I+RWPhRkiksl
  XP_015865812.1  87 GLELNDIQKHFDVPITKAAKELKVGLTVLKKRCRELNIMRWPHRKIKSL 135
                     6899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.76867156IPR003035RWP-RK domain
PfamPF020421.4E-2388135IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MHNNIPCIEF HNFEDFSTSG FFLDNVAHSS QCEDVMVDEK PQTNMMNSFT HLENLTHEKR  60
GLPSLNDNTE EEKRSNNGDD HRKKCAGLEL NDIQKHFDVP ITKAAKELKV GLTVLKKRCR  120
ELNIMRWPHR KIKSLKSLIN SVKEMGLADE IMMLEEHKRL LEVLPDTELT KKTKKLRQAC  180
FKANYKKRRS LQLAHA
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_015865812.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015865811.11e-143protein RKD4-like
SwissprotQ9LVU85e-42RKD4_ARATH; Protein RKD4
TrEMBLA0A2P5E6T33e-69A0A2P5E6T3_TREOI; RWP-RK domain containing protein
STRINGEOY235803e-62(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68983247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.12e-44RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Azpeitia E,Davila-Velderrain J,Villarreal C,Alvarez-Buylla ER
    Gene regulatory network models for floral organ determination.
    Methods Mol. Biol., 2014. 1110: p. 441-69
    [PMID:24395275]