PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc01278.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 459aa    MW: 49953 Da    PI: 8.8798
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc01278.1.g00010.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS251.43.5e-77614522374
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaal 81 
                                   +++++ c+ a++ g+   a+a+L+ +s  asp gd ++R+a+ f+eA a+r +r  ++l  a++ +  +     +   aa+
  Zjn_sc01278.1.g00010.1.sm.mk  61 KHVIMYCVAALDMGNVMTASAALQSISSVASPLGDHLKRVAFTFAEAFARRAMRLLPGLTWAMQLQVPPLPMtPEAINAAR 141
                                   7899*******************************************************9999776665444155555677 PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                   + f  ++P+++++  + N+aIl a++ e++vH++D++  ++ QW+ L++ +a+R+++ppslR+ +v++    + + l++t+
  Zjn_sc01278.1.g00010.1.sm.mk 142 RSFAALCPLVRVAATAVNHAILGAMAAERAVHVVDLGGANPNQWLELIRLFAARSRSPPSLRLSVVNE----EDDFLSSTA 218
                                   77******************************************************************....99******* PP

                          GRAS 163 erLakfAeelgvpfefnvl..vakrledleleeLrvkp.gEalaVnlvlqlhrll...........desvsleserdevLk 229
                                     L++ A +lgv+f fn++    ++++  ++++Lr+ + +Eal++ + lqlhrl            +e+  ++ + d++L+
  Zjn_sc01278.1.g00010.1.sm.mk 219 GLLTQEAVRLGVNFLFNPVrsNIDHFTPTDVSALRIVEgREALVITSTLQLHRLIadevtinlpgvAENNMIT-KADALLR 298
                                   ******************7444445666689999999999***************666666666644444444.59***** PP

                          GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerre 307
                                   ++++ +Pk+vv++eqea hn+e +  r+ +a++yy+alf  le++++  +    +r+ vEr+ll++e +++va  g  rre
  Zjn_sc01278.1.g00010.1.sm.mk 299 VLRDQKPKLVVLTEQEAHHNDEALKCRVKNAFDYYAALFHDLETGAGGLAsgvADRVAVERVLLRNEMMDIVAGDGVLRRE 379
                                   ******************************************99855444455**************************** PP

                          GRAS 308 rhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.....yrve.eesgslvlgWkdrpLvsvSaWr 374
                                   rhe+  +W  r++ aGF+p+p+++ + k+     +  ++ g     yr +  + g+++l+ ++ p++svS+Wr
  Zjn_sc01278.1.g00010.1.sm.mk 380 RHEKITRWLTRMTVAGFEPIPMTYGVIKETAIAAHLLSGSGsnmrmYRAQkVNTGCIFLYARKIPIFSVSVWR 452
                                   ***********************99888765555555444422223666634588999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.26634426IPR005202Transcription factor GRAS
PfamPF035141.2E-7461452IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MNPEGSNNNK GKAVVVKEEP SSLPMLVDAA SPAVPPPLPA APMANIPGPH QYGENRSLFI  60
KHVIMYCVAA LDMGNVMTAS AALQSISSVA SPLGDHLKRV AFTFAEAFAR RAMRLLPGLT  120
WAMQLQVPPL PMTPEAINAA RRSFAALCPL VRVAATAVNH AILGAMAAER AVHVVDLGGA  180
NPNQWLELIR LFAARSRSPP SLRLSVVNEE DDFLSSTAGL LTQEAVRLGV NFLFNPVRSN  240
IDHFTPTDVS ALRIVEGREA LVITSTLQLH RLIADEVTIN LPGVAENNMI TKADALLRVL  300
RDQKPKLVVL TEQEAHHNDE ALKCRVKNAF DYYAALFHDL ETGAGGLASG VADRVAVERV  360
LLRNEMMDIV AGDGVLRRER HEKITRWLTR MTVAGFEPIP MTYGVIKETA IAAHLLSGSG  420
SNMRMYRAQK VNTGCIFLYA RKIPIFSVSV WRPVMSGTE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-29604524375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.11e-123hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF11e-139K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m1e-138(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.16e-57scarecrow-like 3