PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00150.1.g00210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 109aa    MW: 12421.5 Da    PI: 10.0311
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00150.1.g00210.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.83.9e-251056248
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                                  rien   rqvtf+kRr+g+lKKA ELSvLCda + +iifs +gkly+
  Zjn_sc00150.1.g00210.1.am.mk 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDAHIGIIIFSAHGKLYD 56
                                  8********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.52161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-28175IPR002100Transcription factor, MADS-box
CDDcd002653.77E-40279No hitNo description
PRINTSPR004048.8E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.3E-241055IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004048.8E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 109 aa     Download sequence    Send to blast
MARGKIQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD AHIGIIIFSA HGKLYDLATT  60
GTMEELIERY KTASREAQQG DGCGDQRMDP KQETMVLQQE INLLQKGLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-17170169MEF2C
5f28_B2e-17170169MEF2C
5f28_C2e-17170169MEF2C
5f28_D2e-17170169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972486.19e-69MADS-box transcription factor 26
SwissprotA2YQK94e-65MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G84e-65MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0A9TEC72e-68A0A0A9TEC7_ARUDO; Uncharacterized protein
STRINGSi014419m3e-68(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-44AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]