PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00128.1.g01080.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 664aa    MW: 73417.8 Da    PI: 6.3732
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00128.1.g01080.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS363.23.6e-1112396111374
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA+av+++d + a++lL++++++asp+gd +qRla++f+e+L+arla+++s +y++l +++ts    +  l+a+
  Zjn_sc00128.1.g01080.1.am.mk 239 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAY 316
                                   6789************************************************************999998...899***** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +l+  +  + k++++  N +I++a  g++++Hi+D++i +G+QWp++l+ +++R++gpp++RiTg++ p++g   +e++ee
  Zjn_sc00128.1.g01080.1.am.mk 317 QLYMAAICFKKVAFIFSNYTIYNASLGKKKIHIVDYGIRYGFQWPCFLRRISCREGGPPEVRITGIDLPQPGfrPTERIEE 397
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+rL ++A+e+gvpf++++++a+++e+++ e+L+++p+E+l+Vn+++q  +l+desv +es+rd vL+ +++++P+ +++
  Zjn_sc00128.1.g01080.1.am.mk 398 TGRRLGNYAREFGVPFKYHAIAASKMESIRKEDLNIDPDEVLIVNCMYQFRNLMDESVVIESPRDVVLNNIRKMQPHAFIH 478
                                   ********************************************************************************* PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr + nv+aceg +r+er et+++W+ r ++a
  Zjn_sc00128.1.g01080.1.am.mk 479 AIVNGSFSAPFFVTRFREALFYYSALFDILDTTTPRNSDQRMLIEQNIFGRIALNVIACEGIDRVERPETYKQWQVRNQRA 559
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                   G+k++pl++++++ +++ ++ ++ + + ++ ++++l++gWk+r L+++S W+
  Zjn_sc00128.1.g01080.1.am.mk 560 GLKQLPLNQEIVQVVRSKVKDCYHKDFVIDVDHNWLLQGWKGRILYAISTWE 611
                                   ***********************889*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.954213591IPR005202Transcription factor GRAS
PfamPF035141.3E-108239611IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 664 aa     Download sequence    Send to blast
MGSSSYDPSP AGAADPSLYF YLPDLVPGSP SSYLDLPPTP YHEQPPVSSD GGGGNGATGS  60
PEDLVLPYIS RMLMEDDIED KFFYDYPDNP VLLQAQQPFL DILSNSDDSS ATTGDKVAAR  120
SDGPFAPAPP PPSAASVKEE ELVNAAPGAG VSRGRKKPYD DDELEAESGR SSKQSAVQGG  180
DDATRDMLDR VMMPSPESCL QQMQQLRIAM QEEAAKNEAG GKAGNGKANG RGGRKVVDLR  240
TLLIHCAQAV ATDDRRSATE LLKQIKQHAS PQGDGTQRLA HCFAEGLQAR LAGTGSMVYQ  300
SLMAKRTSAV ALLQAYQLYM AAICFKKVAF IFSNYTIYNA SLGKKKIHIV DYGIRYGFQW  360
PCFLRRISCR EGGPPEVRIT GIDLPQPGFR PTERIEETGR RLGNYAREFG VPFKYHAIAA  420
SKMESIRKED LNIDPDEVLI VNCMYQFRNL MDESVVIESP RDVVLNNIRK MQPHAFIHAI  480
VNGSFSAPFF VTRFREALFY YSALFDILDT TTPRNSDQRM LIEQNIFGRI ALNVIACEGI  540
DRVERPETYK QWQVRNQRAG LKQLPLNQEI VQVVRSKVKD CYHKDFVIDV DHNWLLQGWK  600
GRILYAISTW EGPGKELQAA GRRRVASNRE EGELGAPRRR EGCEQQGGGR AESSGARSEC  660
APDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-452436108374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-167SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGLOC_Os12g38490.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-156GRAS family protein