PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00118.1.g00470.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 162aa    MW: 17140.4 Da    PI: 7.781
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00118.1.g00470.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP105.68.1e-3348116573
                           TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                   ++++ ++hTkv gR+RRvR+++ +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++ 
  Zjn_sc00118.1.g00470.1.sm.mk  48 RRTSADRHTKVAGRGRRVRIPVMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEAP 116
                                   67889********************************************************77776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.5E-2751113IPR005333Transcription factor, TCP
PROSITE profilePS5136925.32151105IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MSSPSEIVLY NVVPTQTLNP APATAADLSV SASAPQPQQQ IPVRGRGRRT SADRHTKVAG  60
RGRRVRIPVM VAARVFQLTR ELGHRTDGET IEWLLRQAEP SIIAATGTGV TPEEAPPAAV  120
PVAGSAAAPY MPVPYYTSLL MQPPPVEESA ASASVTNAEE NH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975168.13e-66PREDICTED: transcription factor PCF1-like
SwissprotO238756e-58PCF1_ORYSJ; Transcription factor PCF1
TrEMBLA0A0Q3E6C75e-66A0A0Q3E6C7_BRADI; Uncharacterized protein
TrEMBLI1IW284e-66I1IW28_BRADI; Uncharacterized protein
STRINGBRADI5G02880.11e-65(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69690.16e-30TCP family protein