PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00111.1.g00800.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 498aa    MW: 54229.2 Da    PI: 7.915
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00111.1.g00800.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS247.36e-76914914374
                          GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgd.pmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                    +l+c+ +++ g++ +a+a+L+ ls  +s +gd ++qR++  f+e L +r ++  ++l+ +l+ +   +  +   +++ + 
  Zjn_sc00111.1.g00800.1.am.mk  91 IILQCVACLEMGNAVAASAALQYLSSVVSFAGDvALQRVVLAFAEVLGRRAMQLLPGLAWSLQLKVLLPPPTPAYINSAQW 171
                                   689*****************************559***********************99998776665555555555555 PP

                          GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                                    +  ++P+++++  +aN+aI ea++ e+rvH++D++  ++ QW+aL++ +a+R++gpp lR+T v++    ++  l++ + 
  Zjn_sc00111.1.g00800.1.am.mk 172 sLAMLFPLIRVAATAANNAIKEATAAERRVHVVDLGRANPNQWLALIRLFAARSGGPPFLRLTIVNE----DQSFLSQAAG 248
                                   5******************************************************************....99******** PP

                          GRAS 164 rLakfAeelgvpfefnvl..vakrledleleeLrvkp..gEalaVnlvlqlhrll.........................d 215
                                    L++ A +l+vpf fn++  + +r++  ++ +L v +  gEal++ + lq hrl                           
  Zjn_sc00111.1.g00800.1.am.mk 249 VLTQEAVRLHVPFVFNPVqdHIDRFTPASVAALGVAQgrGEALVITSTLQFHRLIadkvtedlpaesrnkkrknvdtttaT 329
                                   *****************8666677777799999999999************************************988644 PP

                          GRAS 216 esvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                                    s++++ + d++L+++ +l Pk++v++eq+a+hn++ + +r+ +a++yy +lf  lea  + +  +r +vE++ll++e +n
  Zjn_sc00111.1.g00800.1.am.mk 330 TSHEIT-KADALLRVLCDLTPKLMVLTEQDANHNDQVLSNRVRNAFDYYEVLFRDLEAA-GGDPMTREFVEHMLLKEEMKN 408
                                   444444.59***********************************************999.7888***************** PP

                          GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.....eesgslvlgWkdrpLvsvSa 372
                                   +++cega rrerhe+le W  r++ aGF+ +++s++a k++ +l ++ ++dg ++       ++g+l+l+ ++ ++++vSa
  Zjn_sc00111.1.g00800.1.am.mk 409 IISCEGALRRERHEKLEYWFPRMKVAGFELAAVSDDAFKDIASLAHQLSGDGIKWTlgahkIDKGCLLLYSRKISIFAVSA 489
                                   ****************************************************999877665669***************** PP

                          GRAS 373 Wr 374
                                   W+
  Zjn_sc00111.1.g00800.1.am.mk 490 WQ 491
                                   *6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.32962466IPR005202Transcription factor GRAS
PfamPF035142.1E-7391491IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MSSNQSRGNG KAVVAKEEDA EQEIWLVRKK VHHQGGGPSC AGEESSSLSA PAQPAANQGA  60
KAPVEAVPVP DANVPGPQPH GGNLSIFFYD IILQCVACLE MGNAVAASAA LQYLSSVVSF  120
AGDVALQRVV LAFAEVLGRR AMQLLPGLAW SLQLKVLLPP PTPAYINSAQ WSLAMLFPLI  180
RVAATAANNA IKEATAAERR VHVVDLGRAN PNQWLALIRL FAARSGGPPF LRLTIVNEDQ  240
SFLSQAAGVL TQEAVRLHVP FVFNPVQDHI DRFTPASVAA LGVAQGRGEA LVITSTLQFH  300
RLIADKVTED LPAESRNKKR KNVDTTTATT SHEITKADAL LRVLCDLTPK LMVLTEQDAN  360
HNDQVLSNRV RNAFDYYEVL FRDLEAAGGD PMTREFVEHM LLKEEMKNII SCEGALRRER  420
HEKLEYWFPR MKVAGFELAA VSDDAFKDIA SLAHQLSGDG IKWTLGAHKI DKGCLLLYSR  480
KISIFAVSAW QPAKKTSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-1410749122375GRAS family transcription factor containing p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.11e-117hypothetical protein SORBIDRAFT_09g018540
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-56scarecrow-like 3