PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00111.1.g00760.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 389aa    MW: 42529.5 Da    PI: 7.0271
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00111.1.g00760.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS42.31.2e-137016822118
                          GRAS  22 alLarlselaspdgd.pmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsPilkfshltaNq 100
                                   a+L+ ls   s +gd ++qR++  f+eAL+++ ++  ++l+ +l+ +   +  ++  +++ +  f  ++P+++++  +aN+
  Zjn_sc00111.1.g00760.1.am.mk  70 AALQYLSSVMSFAGDvALQRVVVAFAEALERHAMQLLPGLAWSLQLKVLLPPPTAAYINSAQWsFAMLFPLIRLAAAAANN 150
                                   68999999999999549************************99988776666666666665555***************** PP

                          GRAS 101 aIleavegeervHiiDfd 118
                                   +I ea+  e+rvH++D++
  Zjn_sc00111.1.g00760.1.am.mk 151 TIKEATPAEHRVHVVDLG 168
                                   ****************97 PP

2GRAS93.33.7e-29171370149321
                          GRAS 149 spesgskeeleetgerLakfAeelgvpfefnvl..vakrledleleeLrvkp..gEalaVnlvlqlhrll........... 214
                                   +p+++++  l++ +  L++ A +l+vp+ fn++  + +r+   ++ +L v +  gEal++ + lq h+l            
  Zjn_sc00111.1.g00760.1.am.mk 171 NPNHEDQSFLSQAAGVLTQEAVRLHVPVVFNPVqdHIDRFIPASVAALGVAQgrGEALVITSTLQFHHLIadkvtedlpak 251
                                   5566788889999999****************755555666669999***9999*************************** PP

                          GRAS 215 ..............desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpresee 281
                                                   s++++ + d++L+++ +l Pk++v++eq a hn+e + +r+ +a++yy +lf  le   + +   
  Zjn_sc00111.1.g00760.1.am.mk 252 shskkrknmdtttaTTSHEIT-KADALLRVLCDLTPKLMVLTEQYAYHNGEVLSNRVRNAFDYYEVLFRDLEDA-GGDPMM 330
                                   *********988644444444.59***********************************************887.68889* PP

                          GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                   r  v ++ll++e++n+++cega++rerhe+le W  r+++
  Zjn_sc00111.1.g00760.1.am.mk 331 RGLVQHMLLKEELMNIISCEGAQHRERHENLEYWLPRMMR 370
                                   **********************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.90822389IPR005202Transcription factor GRAS
PfamPF035144.1E-1170168IPR005202Transcription factor GRAS
PfamPF035141.3E-26171370IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MSLNQSRGKG KAEVAKEDDA EQEIWLMKKK VHHQGSGPSC AGEESSSLAT APAQPPANLG  60
GDSAGGGSSA ALQYLSSVMS FAGDVALQRV VVAFAEALER HAMQLLPGLA WSLQLKVLLP  120
PPTAAYINSA QWSFAMLFPL IRLAAAAANN TIKEATPAEH RVHVVDLGGA NPNHEDQSFL  180
SQAAGVLTQE AVRLHVPVVF NPVQDHIDRF IPASVAALGV AQGRGEALVI TSTLQFHHLI  240
ADKVTEDLPA KSHSKKRKNM DTTTATTSHE ITKADALLRV LCDLTPKLMV LTEQYAYHNG  300
EVLSNRVRNA FDYYEVLFRD LEDAGGDPMM RGLVQHMLLK EELMNIISCE GAQHRERHEN  360
LEYWLPRMMR SRKSRAWHTK CQVMAASGH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.13e-80hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF12e-86K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m5e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-30scarecrow-like 3