PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00107.1.g00410.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 280aa    MW: 29711.4 Da    PI: 5.2644
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00107.1.g00410.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.4e-11179237563
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l++e+
  Zjn_sc00107.1.g00410.1.sm.mkhc 179 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTLLQRDTNGLTTEN 237
                                     9*********************************************9998888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-16175239IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.887177240IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.2E-11179230No hitNo description
PfamPF001702.6E-9179236IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.4E-11179233No hitNo description
CDDcd147031.21E-24180229No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MNKDKAPMPG DGGLPPESSR VVGAPSKSST PPPECDINRM PDFPTRNTGH RRAHSEILSL  60
PDDLDLSGPG GGDGPSLSDE NDEELFSMFL DVDKLNSSCG MLSEAEAESS SAAVGGGEEA  120
GPGQAPRPRH QHSQSMDESM SIKAEELVGA PGTEGMSPAE AKKAVSAAKL AELALVDPKR  180
AKRIWANRQS AARSKERKMR YIAELERKVQ TLQTEATTLS AQLTLLQRDT NGLTTENSEL  240
KIPLNDTLRA EVQRLKVATG QVASSGGGVR MLVSGVLLCK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652949.11e-149transcription factor RF2a
SwissprotQ69IL41e-125RF2A_ORYSJ; Transcription factor RF2a
TrEMBLA0A1D6I8V31e-148A0A1D6I8V3_MAIZE; Putative transcription factor PosF21
TrEMBLA0A3L6DZU61e-148A0A3L6DZU6_MAIZE; Transcription factor RF2a
STRINGSb02g029870.11e-141(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-59bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]