PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00096.1.g00760.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 221aa    MW: 24441.8 Da    PI: 6.785
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00096.1.g00760.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.81e-211053245
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                                  + en+s rq+t+skRr gilKKA+ELS+LCd++  +++fs+tgk
  Zjn_sc00096.1.g00760.1.sm.mk 10 KLENSSGRQITYSKRRSGILKKAKELSILCDIDLILLMFSPTGK 53
                                  679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.474153IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-22264IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-18323IPR002100Transcription factor, MADS-box
PfamPF003193.3E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRQIT YSKRRSGILK KAKELSILCD IDLILLMFSP TGKPTICIGD  60
KRKLESLEEN VAKQHMIGLQ CAAAQFQNDM QLPLGLTGEP NVSQWFHSGS IDMQQPVMLP  120
DDPSLLHQRD IGCSTGTSLQ SYPGYFSMSK HSTDTGGGSE HGQPSLQQTP PPDFSHADCL  180
TSLHLGAQFP YTPFDHTSLL NERMFRPDVV ELHDGDAINF S
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025828481.17e-79agamous-like MADS-box protein AGL65
TrEMBLB9G8P51e-102B9G8P5_ORYSJ; Uncharacterized protein
STRINGLPERR11G18320.12e-93(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.14e-21AGAMOUS-like 30