PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00096.1.g00210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 1255aa    MW: 140750 Da    PI: 6.7058
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00096.1.g00210.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS275.31.9e-842345953364
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lLl+cAeav++++ + a +lL++++++as +gd+ qRla++f ++L+ar+++++++l + +++++ s   + e ++a++l
  Zjn_sc00096.1.g00210.1.am.mk 234 TLLLHCAEAVAANNRTVAGELLKQIKQNASATGDARQRLAQCFSKGLEARVLGTGNQLWNLVTAERPS---VLELAKAYRL 311
                                   68********************************************************9988888887...9********* PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleet 161
                                      ++ + k++++   ++I++a+ g++rvH++D+++ +G++W+ L++ +a +R++g ++l+iT+++ ++s   s++ +ee 
  Zjn_sc00096.1.g00210.1.am.mk 312 SMAACCFSKVAFIFSIKTIMDAIVGKSRVHVVDYGMHYGFHWAELIRLMAkDRDGGRAELKITAIVCSRSLfwSAQGIEEQ 392
                                   **************************************************8899************988779********* PP

                          GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvv 240
                                   g+rL+k A ++g++f+f+ ++a+++e++++++L++++gE+l+Vn +++ ++l+des+  ++  +rd vL+ +++++P+v++
  Zjn_sc00096.1.g00210.1.am.mk 393 GRRLSKCAGKFGLSFKFHSITATKWECVRIQDLNTDTGEVLIVNDMYNFMTLMDESMLFDEpsPRDIVLSNIRNMRPDVFI 473
                                   ********************************************************98776669***************99 PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                    +  +++ n++sFl rf eal yy+alfd ++a++pr+se r ++E+ellg+++ nvvaceg++   r e++++ ++r ++
  Zjn_sc00096.1.g00210.1.am.mk 474 QSIVNSS-NGGSFLSRFREALFYYTALFDVFDATMPRQSESRLVLEQELLGNHLLNVVACEGRDLMGRPEKYRQCQARNQR 553
                                   8877654.899********************************************************************** PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                                   aG+k++pl+  ++k +k  ++++++d +++ e+ ++l++gW+ 
  Zjn_sc00096.1.g00210.1.am.mk 554 AGLKQLPLKPGIVKGIKESVKTHHKD-FMLGEDGQWLLQGWMA 595
                                   ************************77.**************85 PP

2GRAS317.92.2e-9787912472373
                          GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80  
                                      lLl+cAe v ++ ++ a++lL++++ +asp+gd++qRla++f+eAL++rla+++ + +      + + ++ ++ l+a
  Zjn_sc00096.1.g00210.1.am.mk  879 HALLLRCAETVMDDGQRGARELLEKIKRHASPTGDATQRLAHCFAEALETRLAGMGAHRS------SFTIHQPVRFLKA 951 
                                    579***************************************************544444......3333346789*** PP

                          GRAS   81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skee 157 
                                    + l+  ++ + k++++ +N+ I++a++g +r+Hi+D+++ +G+QWp Ll+ La+R++gpp++ iTg++  ++   s++ 
  Zjn_sc00096.1.g00210.1.am.mk  952 YPLYIATCCFNKVAFMFCNRSIYQAAAGRSRLHIVDYGVCHGFQWPVLLRWLAAREGGPPQVTITGIVLTKHWyrSSDH 1030
                                    *********************************************************************666699**** PP

                          GRAS  158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvksl 234 
                                    +eetg+rL++ A+elgvpf+f++++a ++++++le+L+v+p+ alaVn+ ++l+ + d+sv ++   +rd vL  ++++
  Zjn_sc00096.1.g00210.1.am.mk 1031 IEETGHRLSNCARELGVPFKFQAIMAAKWDAVHLEDLSVDPDAALAVNSLFSLEMMDDDSVVVDRasPRDVVLGNIRRM 1109
                                    *********************************************************99987766669*********** PP

                          GRAS  235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetle 313 
                                    +P v+++   +  + ++sFl+rf e+l +ysa+fd+l+a++pr se+r ++E  +lg  + n++aceg++r+ r e+++
  Zjn_sc00096.1.g00210.1.am.mk 1110 RPAVFTIGIVNGLC-GSSFLTRFRETLVHYSAMFDMLDATMPRGSEQRLVLESDMLGSFALNIIACEGQDRTDRFESYK 1187
                                    **********9988.779************************************************************* PP

                          GRAS  314 kWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                                    +W++r+++a ++++pl+ ++   +  ++++ + + + ++e++ +l++gWk+r L++ S W
  Zjn_sc00096.1.g00210.1.am.mk 1188 QWHMRMQRAELRQLPLDRDIIGAVTDMVKQQYHKDFVIHEDRRWLLQGWKGRILFAHSTW 1247
                                    *****************************999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.328206586IPR005202Transcription factor GRAS
PfamPF035146.5E-82234595IPR005202Transcription factor GRAS
PROSITE profilePS5098553.5348521228IPR005202Transcription factor GRAS
PfamPF035147.6E-958791247IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1255 aa     Download sequence    Send to blast
MATTPEEFFV ESLVKPAPSS PSVFLDLPPT PDGNTDDPPS PGNILHLLRE DGIDDDLLYQ  60
CSDHHALLQA QQPFAQILSS PSSFVTNNDN RRGDTGTQGS KDPLQGGSGD LSSPFFKGAD  120
VVEAFLKGME EATRFLPGEN SIRSKAIKKR YGRDDYLEEE EVTRTSKTTM KKTAEPEEVD  180
IVGEMMLRGN EACVEDMQKL RIAMDTEEEE GRKNKTRGKG VSKAAGDVVT DLPTLLLHCA  240
EAVAANNRTV AGELLKQIKQ NASATGDARQ RLAQCFSKGL EARVLGTGNQ LWNLVTAERP  300
SVLELAKAYR LSMAACCFSK VAFIFSIKTI MDAIVGKSRV HVVDYGMHYG FHWAELIRLM  360
AKDRDGGRAE LKITAIVCSR SLFWSAQGIE EQGRRLSKCA GKFGLSFKFH SITATKWECV  420
RIQDLNTDTG EVLIVNDMYN FMTLMDESML FDEPSPRDIV LSNIRNMRPD VFIQSIVNSS  480
NGGSFLSRFR EALFYYTALF DVFDATMPRQ SESRLVLEQE LLGNHLLNVV ACEGRDLMGR  540
PEKYRQCQAR NQRAGLKQLP LKPGIVKGIK ESVKTHHKDF MLGEDGQWLL QGWMASNGRL  600
IFEWILNRWA KEKLLNARNQ VAAVTSSSTM ASAPKDQTGL DEPLPPSTSS ILLLPTFPLE  660
QQQEQEHTPL LEYISRMLME EEDRVLLQYH DDHPVLIQAQ QSLAQVISSS STSDNNASTT  720
KPSFSKALLA DERNSNLLFS SDGTILSRSA TSVVCNTDIE NATARAAAAE HDWRHAATMS  780
FLMGMAEASK FLPRHSNLVF KTINTHDTGA EVSRASKLMA MAETEEAFLL QTTIDRMMLN  840
DCKLSRGEME DLRAAMKNEA VARRQERRQR KRLLQVDLHA LLLRCAETVM DDGQRGAREL  900
LEKIKRHASP TGDATQRLAH CFAEALETRL AGMGAHRSSF TIHQPVRFLK AYPLYIATCC  960
FNKVAFMFCN RSIYQAAAGR SRLHIVDYGV CHGFQWPVLL RWLAAREGGP PQVTITGIVL  1020
TKHWYRSSDH IEETGHRLSN CARELGVPFK FQAIMAAKWD AVHLEDLSVD PDAALAVNSL  1080
FSLEMMDDDS VVVDRASPRD VVLGNIRRMR PAVFTIGIVN GLCGSSFLTR FRETLVHYSA  1140
MFDMLDATMP RGSEQRLVLE SDMLGSFALN IIACEGQDRT DRFESYKQWH MRMQRAELRQ  1200
LPLDRDIIGA VTDMVKQQYH KDFVIHEDRR WLLQGWKGRI LFAHSTWVAD DAYSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3723612478374GRAS family transcription factor containing p
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-106GRAS family protein