PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00090.1.g00790.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CAMTA
Protein Properties Length: 452aa    MW: 50839 Da    PI: 5.9777
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00090.1.g00790.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-156.74.8e-18529574117
                            CG-1  74 KvggvevlycyYahseenptfqrrcywlLeeelekivlvhylev 117
                                     +vg+v++l+cyYah+e+np fqrrc+w+Le ++e+ivlv+y++v
  Zjn_sc00090.1.g00790.1.sm.mkhc  52 RVGNVDALSCYYAHGEQNPCFQRRCFWMLEPAYEHIVLVQYRDV 95 
                                     699***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143726.2891101IPR005559CG-1 DNA-binding domain
SMARTSM010761.7E-201096IPR005559CG-1 DNA-binding domain
PfamPF038592.4E-135295IPR005559CG-1 DNA-binding domain
SuperFamilySSF484034.97E-14114191IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029714.186117189IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.3E-14117190IPR020683Ankyrin repeat-containing domain
CDDcd002043.97E-13118189No hitNo description
PROSITE profilePS5008810.766130162IPR002110Ankyrin repeat
SMARTSM002485.2E-4130159IPR002110Ankyrin repeat
PfamPF136371.3E-5132188No hitNo description
SMARTSM002482800169198IPR002110Ankyrin repeat
PROSITE profilePS500967.602251280IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MSESFDINVL REEARTRWLR PAEVYYILQN HERFPITPEP PKKPPSIAHI PRVGNVDALS  60
CYYAHGEQNP CFQRRCFWML EPAYEHIVLV QYRDVAEPSG SAKNVEAAGF EWALSSVLSA  120
GVGINFRDSN GWTALHWAAY FGREKMVATI LAAGASATAV TDPTAQDPVG KTAAFLASER  180
GHMGLAGYLS EVSLTSHLAS LTIEESEISK GSAAVEAERA VESISQRSAK RQGGTEDELS  240
MKDSLAAVRN AAQAAARIQN AFRAFSFRKR QQKTARLRDE YGMTQEDIDE LAAAAASRSY  300
HQNHALNGQF YNKAAAHVRG HQVRKKYKTF VSTVSVLEKV ILRWRRRRQG LRGFRAEQPT  360
MIVAEEEEEE EEDDDDVDFE DDEATRMFRR QKVDEALKEA VSRVLFMVES PEARMQYRRM  420
LEEFRQATAE LGGSEVTSLF NSELVGLDSF MH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975409.11e-157PREDICTED: calmodulin-binding transcription activator 4 isoform X3
SwissprotQ9FYG23e-87CMTA4_ARATH; Calmodulin-binding transcription activator 4
TrEMBLM0XBX91e-159M0XBX9_HORVD; Uncharacterized protein
STRINGMLOC_58709.11e-155(Hordeum vulgare)
STRINGSi009249m1e-154(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62383241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67310.12e-61Calmodulin-binding transcription activator protein with CG-1 and Ankyrin domains